| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | Rita3 sp |
| MS data file | : | PRT1270_T-BRSC_3_20250714120051.mgf |
| Database | : | SwissProt 57.15 (515,203 sequences; 181,334,896 residues) |
| Timestamp | : | 12 Aug 2025 at 23:41:29 GMT |
Not what you expected? Try
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | GluC_Trypsin |
| Fixed modifications | : | |
| Variable modifications | : | |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 5,012 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 | 2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | ||||
| 6.2e-007 | 1 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | ||||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle (
) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 746.3831 | 2236.1275 | 2236.1535 | -11.6 | 1 | 8 | 0.93 | 1Score > 39 indicates identityScore > 20 indicates homology |
IHQDGIHILVNMNGYTKGAR | |
| 531.2930 | 530.2857 | 530.2813 | 8.44 | 1 | 8 | 0.78 | 1Score > 46 indicates identityScore > 20 indicates homology |
ARGDI | |
| 412.2328 | 822.4510 | 822.4599 | -10.8 | 1 | 8 | 0.48 | 1Score > 39 indicates identityScore > 17 indicates homology |
YGQKSIK | |
| 886.4586 | 1770.9026 | 1770.9325 | -16.8 | 0 | 8 | 0.89 | 1Score > 40 indicates identityScore > 20 indicates homology |
ILDLQAPIMSLQSVLE + 2 Deamidated (NQ) | |
| 964.0328 | 1926.0510 | 1926.0397 | 5.90 | 1 | 8 | 0.71 | 1Score > 36 indicates identityScore > 19 indicates homology |
VIQPIQSIFRVSHCIK + 2 Deamidated (NQ) | |
| 662.3713 | 1322.7280 | 1322.7194 | 6.53 | 0 | 8 | 0.66 | 1Score > 38 indicates identityScore > 19 indicates homology |
TPVILIDPQGNR + Deamidated (NQ) | |
| 759.9182 | 1517.8218 | 1517.8487 | -17.7 | 1 | 8 | 0.86 | 1Score > 39 indicates identityScore > 20 indicates homology |
ILNKQSGMLGISLK + Deamidated (NQ); Oxidation (M) | |
| 691.4093 | 2071.2061 | 2071.1711 | 16.9 | 1 | 8 | 0.43 | 1Score > 31 indicates identityScore > 17 indicates homology |
LTVIKNLVDSAQAMVLALR + Deamidated (NQ); Oxidation (M) | |
| 647.3420 | 1292.6694 | 1292.6646 | 3.77 | 0 | 8 | 0.9 | 1Score > 41 indicates identityScore > 20 indicates homology |
TALAMGLSQSLGK + Deamidated (NQ); Oxidation (M) | |
| 715.3663 | 2143.0771 | 2143.0949 | -8.33 | 1 | 8 | 0.66 | 1Score > 39 indicates identityScore > 19 indicates homology |
TFPPTAAQLQQLKQLHYR + 4 Deamidated (NQ) | |
| 833.4631 | 1664.9116 | 1664.8821 | 17.8 | 1 | 8 | 0.7 | 1Score > 37 indicates identityScore > 19 indicates homology |
GKAPIGRPSPMSPWGK | |
| 834.4456 | 1666.8766 | 1666.8460 | 18.4 | 1 | 8 | 0.78 | 1Score > 39 indicates identityScore > 20 indicates homology |
HNARALVNAGAAIMIE + Deamidated (NQ); Oxidation (M) | |
| 473.0092 | 1888.0077 | 1888.0306 | -12.1 | 1 | 8 | 0.65 | 1Score > 38 indicates identityScore > 19 indicates homology |
VQFVQNITDIDDKIIK | |
| 541.0254 | 2160.0725 | 2160.0919 | -8.98 | 1 | 8 | 0.82 | 1Score > 39 indicates identityScore > 20 indicates homology |
ELDVQDVNVAITMCVLGLR + Oxidation (M) | |
| 732.3935 | 731.3862 | 731.3926 | -8.69 | 1 | 8 | 0.94 | 1Score > 43 indicates identityScore > 20 indicates homology |
KGGLSNR + Deamidated (NQ) | |
| 622.8292 | 2487.2877 | 2487.2719 | 6.33 | 1 | 8 | 0.31 | 1Score > 37 indicates identityScore > 16 indicates homology |
TALPAWVEFMSLALQDVPVQQK + Deamidated (NQ); Oxidation (M) | |
| 546.9953 | 1637.9641 | 1637.9716 | -4.60 | 0 | 8 | 0.65 | 1Score > 31 indicates identityScore > 19 indicates homology |
LLQLNGSLVVVGIVGR + 2 Deamidated (NQ) | |
| 906.4395 | 1810.8644 | 1810.8771 | -6.98 | 1 | 8 | 0.36 | 1Score > 40 indicates identityScore > 16 indicates homology |
QGLEAMGAGLASVTYQAK + Deamidated (NQ); Oxidation (M) | |
| 598.8383 | 1195.6620 | 1195.6601 | 1.65 | 1 | 8 | 0.84 | 1Score > 38 indicates identityScore > 20 indicates homology |
KGIPYAYVASK | |
| 851.1255 | 2550.3547 | 2550.3905 | -14.0 | 1 | 8 | 0.2 | 1Score > 35 indicates identityScore > 14 indicates homology |
NASVPQILIIVTDGKSQGDVALPSK + Deamidated (NQ) | |
| 1181.1156 | 2360.2166 | 2360.1722 | 18.8 | 1 | 8 | 0.53 | 1Score > 38 indicates identityScore > 18 indicates homology |
FIMQINDDIPQRASLPQPFK + 3 Deamidated (NQ) | |
| 805.9738 | 1609.9330 | 1609.9291 | 2.48 | 1 | 8 | 0.4 | 1Score > 34 indicates identityScore > 17 indicates homology |
SLVPLEDLQGVLSLK | |
| 787.4094 | 2359.2064 | 2359.1689 | 15.9 | 1 | 8 | 0.29 | 1Score > 38 indicates identityScore > 15 indicates homology |
TLGQQVLVENMGGAGGSLGAANVAK + 2 Deamidated (NQ); Oxidation (M) | |
| 1087.0425 | 2172.0704 | 2172.0409 | 13.6 | 1 | 8 | 0.83 | 1Score > 39 indicates identityScore > 20 indicates homology |
NTMYAQVFNLQGKTPVSQK + 3 Deamidated (NQ); Oxidation (M) | |
| 809.4374 | 808.4301 | 808.4304 | -0.31 | 0 | 8 | 0.28 | 1Score > 40 indicates identityScore > 15 indicates homology |
QLAAGGHR | |
| 765.4330 | 1528.8514 | 1528.8759 | -16.0 | 1 | 8 | 0.39 | 1Score > 37 indicates identityScore > 16 indicates homology |
IVQTLCTVRGAALK | |
| 304.1628 | 606.3110 | 606.3159 | -8.06 | 0 | 8 | 0.57 | 1Score > 43 indicates identityScore > 18 indicates homology |
MVTTR | |
| 578.3037 | 1154.5928 | 1154.6084 | -13.5 | 0 | 8 | 0.49 | 1Score > 40 indicates identityScore > 17 indicates homology |
GNIYVYASLR | |
| 644.7041 | 1931.0905 | 1931.0887 | 0.93 | 1 | 8 | 1 | 1Score > 32 indicates identityScore > 20 indicates homology |
MINIVNNKVNIIHRPR + Deamidated (NQ) | |
| 351.9377 | 1403.7217 | 1403.7078 | 9.87 | 1 | 8 | 0.97 | 1Score > 41 indicates identityScore > 20 indicates homology |
ARDAAQMVADLVK + Deamidated (NQ); Oxidation (M) | |
| 368.2251 | 734.4356 | 734.4439 | -11.2 | 1 | 8 | 0.85 | 1Score > 36 indicates identityScore > 20 indicates homology |
LTFKAR | |
| 813.8971 | 1625.7796 | 1625.7896 | -6.15 | 1 | 8 | 0.78 | 1Score > 40 indicates identityScore > 19 indicates homology |
TVGPNSQEALLPQNR + 3 Deamidated (NQ) | |
| 584.9802 | 1751.9188 | 1751.9319 | -7.47 | 0 | 8 | 0.56 | 1Score > 39 indicates identityScore > 18 indicates homology |
LQYPQDAVLALTQHR | |
| 586.9850 | 1757.9332 | 1757.9273 | 3.34 | 1 | 8 | 0.72 | 1Score > 39 indicates identityScore > 19 indicates homology |
YKQISNLLVLYMQK + 2 Deamidated (NQ); Oxidation (M) | |
| 907.4951 | 1812.9756 | 1812.9842 | -4.70 | 1 | 8 | 0.89 | 1Score > 38 indicates identityScore > 20 indicates homology |
IVVCITEGIPVLDMVR | |
| 660.3278 | 1977.9616 | 1977.9288 | 16.6 | 1 | 8 | 0.48 | 1Score > 40 indicates identityScore > 17 indicates homology |
MSAIFSFQSLARCSQTK + Deamidated (NQ); Oxidation (M) | |
| 714.0527 | 2139.1363 | 2139.1423 | -2.82 | 1 | 8 | 0.66 | 1Score > 37 indicates identityScore > 19 indicates homology |
IVIATDSVIQPARALVTDQE + Deamidated (NQ) | |
| 1015.4973 | 3043.4701 | 3043.4525 | 5.77 | 1 | 8 | 1 | 1Score > 37 indicates identityScore > 20 indicates homology |
LVLMGSAGVSFPITEGLDAVWGYNPSFAE + Deamidated (NQ); Oxidation (M) | |
| 379.2155 | 756.4164 | 756.4130 | 4.57 | 0 | 8 | 0.56 | 1Score > 39 indicates identityScore > 18 indicates homology |
ANTVVPR + Deamidated (NQ) | |
| 313.1796 | 936.5170 | 936.5141 | 3.08 | 1 | 8 | 0.76 | 1Score > 38 indicates identityScore > 19 indicates homology |
AHSAPKAQK | |
| 775.9039 | 1549.7932 | 1549.8174 | -15.6 | 1 | 8 | 0.77 | 1Score > 41 indicates identityScore > 19 indicates homology |
VVLSFAAEMLVQAR + Deamidated (NQ); Oxidation (M) | |
| 584.7867 | 2335.1177 | 2335.1339 | -6.94 | 1 | 8 | 0.36 | 1Score > 39 indicates identityScore > 16 indicates homology |
NASKGPHSPQVPSQVQSPMTSR + Oxidation (M) | |
| 842.4584 | 2524.3534 | 2524.3286 | 9.83 | 1 | 8 | 0.29 | 1Score > 35 indicates identityScore > 15 indicates homology |
DTVVVDLLGLNKGVAWVNGNNLGR + 2 Deamidated (NQ) | |
| 552.8279 | 1103.6412 | 1103.6260 | 13.8 | 1 | 8 | 0.36 | 1Score > 37 indicates identityScore > 16 indicates homology |
KVVLLGMSLE + Oxidation (M) | |
| 959.0070 | 1915.9994 | 1916.0268 | -14.3 | 1 | 8 | 0.85 | 1Score > 39 indicates identityScore > 20 indicates homology |
IDAVRAAFNAVGQLSWAK | |
| 649.7169 | 1946.1289 | 1946.1029 | 13.3 | 0 | 8 | 0.79 | 1Score > 30 indicates identityScore > 19 indicates homology |
LLGNPWGFFLSSLIIIR + Deamidated (NQ) | |
| 769.7083 | 2306.1031 | 2306.1464 | -18.8 | 1 | 8 | 0.58 | 1Score > 39 indicates identityScore > 18 indicates homology |
FQSDLKIINDCLDGLIQNAK + 2 Deamidated (NQ) | |
| 844.7614 | 2531.2624 | 2531.2220 | 15.9 | 0 | 8 | 0.36 | 1Score > 38 indicates identityScore > 16 indicates homology |
FDEPWTLLQNQNGLLTWLVDE + Deamidated (NQ) | |
| 967.5001 | 1932.9856 | 1933.0165 | -16.0 | 1 | 8 | 0.73 | 1Score > 39 indicates identityScore > 19 indicates homology |
YNITILMITHEMSVIR | |
| 701.8635 | 2803.4249 | 2803.4062 | 6.67 | 1 | 8 | 0.31 | 1Score > 37 indicates identityScore > 15 indicates homology |
GNDVIANDLENLAASFQAAVVDVLMAK + Oxidation (M) | |
| 939.1823 | 2814.5251 | 2814.5396 | -5.17 | 1 | 8 | 0.24 | 1Score > 32 indicates identityScore > 14 indicates homology |
MRTLGAMAIMLVVMGTVIFLSFILR + 2 Oxidation (M) | |
| 801.1005 | 2400.2797 | 2400.2511 | 11.9 | 1 | 8 | 0.66 | 1Score > 36 indicates identityScore > 19 indicates homology |
AEIAGHTVWLLKPATFMNLSGK + Deamidated (NQ); Oxidation (M) | |
| 644.7046 | 1931.0920 | 1931.0887 | 1.71 | 1 | 8 | 1 | 1Score > 32 indicates identityScore > 20 indicates homology |
MINIVNNKVNIIHRPR + Deamidated (NQ) | |
| 692.7155 | 2075.1247 | 2075.1296 | -2.39 | 1 | 8 | 0.38 | 1Score > 36 indicates identityScore > 16 indicates homology |
SVVINTLCQAQTKLGLTTK + Deamidated (NQ) | |
| 737.3911 | 2945.5353 | 2945.4917 | 14.8 | 1 | 8 | 0.41 | 1Score > 35 indicates identityScore > 17 indicates homology |
DVRNCSTSPPYLPVTAVNTTAQLTALR + Deamidated (NQ) | |
| 690.3713 | 1378.7280 | 1378.7014 | 19.4 | 0 | 8 | 0.77 | 1Score > 39 indicates identityScore > 19 indicates homology |
NISLMTLDSLQK + Deamidated (NQ); Oxidation (M) | |
| 851.4611 | 1700.9076 | 1700.8985 | 5.40 | 1 | 8 | 0.86 | 1Score > 39 indicates identityScore > 20 indicates homology |
STLQPENSVPIKPYK + Deamidated (NQ) | |
| 668.3340 | 2001.9802 | 2001.9948 | -7.32 | 1 | 8 | 0.33 | 1Score > 40 indicates identityScore > 16 indicates homology |
NPHYRYPITQNLFPLE + Deamidated (NQ) | |
| 680.3531 | 2038.0375 | 2038.0273 | 5.01 | 1 | 8 | 0.34 | 1Score > 39 indicates identityScore > 16 indicates homology |
RHGSVVGIPYWDTVVPQE | |
| 405.8962 | 1214.6668 | 1214.6619 | 4.03 | 1 | 8 | 0.8 | 1Score > 40 indicates identityScore > 19 indicates homology |
DGTNLLQGLKR + Deamidated (NQ) | |
| 700.0079 | 2097.0019 | 2097.0387 | -17.6 | 0 | 8 | 0.61 | 1Score > 39 indicates identityScore > 18 indicates homology |
NFDFRPGMIIINLDLMR + Deamidated (NQ); 2 Oxidation (M) | |
| 1038.8264 | 3113.4574 | 3113.5014 | -14.1 | 1 | 8 | 0.42 | 1Score > 36 indicates identityScore > 17 indicates homology |
KNLPNNAGDLGLGAGAATPGSSQDFTVNVGDR + Deamidated (NQ) | |
| 465.8990 | 1394.6752 | 1394.6929 | -12.7 | 0 | 8 | 0.46 | 1Score > 41 indicates identityScore > 17 indicates homology |
NIVPILADANQPE + 2 Deamidated (NQ) | |
| 338.2079 | 674.4012 | 674.3897 | 17.1 | 1 | 8 | 0.88 | 1Score > 39 indicates identityScore > 20 indicates homology |
AAMKVR | |
| 816.4521 | 1630.8896 | 1630.8719 | 10.9 | 0 | 8 | 0.97 | 1Score > 38 indicates identityScore > 20 indicates homology |
LTLHGLQQYFVALE | |
| 495.2803 | 1977.0921 | 1977.0968 | -2.40 | 0 | 8 | 0.33 | 1Score > 35 indicates identityScore > 15 indicates homology |
EPLLLLLSPAAATVGEPMR | |
| 660.3581 | 1978.0525 | 1978.0234 | 14.7 | 0 | 8 | 0.68 | 1Score > 37 indicates identityScore > 19 indicates homology |
IGYFGQPLTDAPGALALMK + Oxidation (M) | |
| 679.0244 | 2034.0514 | 2034.0390 | 6.06 | 1 | 8 | 0.68 | 1Score > 39 indicates identityScore > 19 indicates homology |
MFDRILLDAPCSATGVIR | |
| 548.2958 | 1641.8656 | 1641.8475 | 11.0 | 1 | 8 | 0.6 | 1Score > 40 indicates identityScore > 18 indicates homology |
NARNGHLFVTDGIVK + 2 Deamidated (NQ) | |
| 637.3323 | 1908.9751 | 1908.9707 | 2.29 | 1 | 8 | 0.24 | 1Score > 39 indicates identityScore > 14 indicates homology |
FYNQHLINHVGRGTPR + Deamidated (NQ) | |
| 601.9862 | 1802.9368 | 1802.9567 | -11.0 | 0 | 8 | 0.75 | 1Score > 39 indicates identityScore > 19 indicates homology |
LGGQWPPTGVKPLNPLE + Deamidated (NQ) | |
| 603.3420 | 1807.0042 | 1807.0131 | -4.96 | 1 | 8 | 0.98 | 1Score > 35 indicates identityScore > 20 indicates homology |
LFLGVVFNKLDISVDK + Deamidated (NQ) | |
| 808.4551 | 1614.8956 | 1614.8941 | 0.98 | 1 | 8 | 0.65 | 1Score > 37 indicates identityScore > 18 indicates homology |
VLQTLGPTRSSSQLK + Deamidated (NQ) | |
| 798.0889 | 2391.2449 | 2391.2124 | 13.6 | 1 | 8 | 0.39 | 1Score > 37 indicates identityScore > 16 indicates homology |
TVAFQWPAGFYSDGIHIGLRR + Deamidated (NQ) | |
| 767.4147 | 2299.2223 | 2299.2093 | 5.64 | 0 | 8 | 0.71 | 1Score > 37 indicates identityScore > 19 indicates homology |
AIIALLTLMQDNGITADAVAGAR + 2 Deamidated (NQ) | |
| 1134.6208 | 3400.8406 | 3400.8655 | -7.33 | 0 | 8 | 1 | 1Score > 31 indicates identityScore > 20 indicates homology |
MIEPLLCGIVLGLVPITLLGLFVSAWNQYR + Oxidation (M) | |
| 590.9619 | 1769.8639 | 1769.8910 | -15.3 | 1 | 8 | 0.68 | 1Score > 40 indicates identityScore > 19 indicates homology |
MVTLLNFDPSFKLTE + Oxidation (M) | |
| 524.5314 | 2094.0965 | 2094.0997 | -1.54 | 1 | 8 | 0.49 | 1Score > 38 indicates identityScore > 17 indicates homology |
EGVIAVYDLGGGTFDISILR | |
| 773.7633 | 2318.2681 | 2318.3097 | -17.9 | 1 | 8 | 1 | 1Score > 34 indicates identityScore > 20 indicates homology |
SPNPQLLTIPEAATILLASLQK + Deamidated (NQ) | |
| 538.9841 | 1613.9305 | 1613.9141 | 10.1 | 0 | 8 | 0.64 | 1Score > 34 indicates identityScore > 18 indicates homology |
LIGQQGLVDGVFLVR + Deamidated (NQ) | |
| 469.2702 | 1873.0517 | 1873.0343 | 9.31 | 1 | 8 | 0.91 | 1Score > 34 indicates identityScore > 20 indicates homology |
MAKLQQLVQAIQSGTIK + Deamidated (NQ); Oxidation (M) | |
| 908.4236 | 3629.6653 | 3629.6952 | -8.25 | 1 | 8 | 1 | 1Score > 33 indicates identityScore > 20 indicates homology |
FSHMTAIAPNATSSIIMGNTSPSCEPFRANIYK + Deamidated (NQ); Oxidation (M) | |
| 722.3765 | 1442.7384 | 1442.7187 | 13.7 | 1 | 8 | 0.51 | 1Score > 41 indicates identityScore > 17 indicates homology |
LQQLKDMSSHQK + Deamidated (NQ) | |
| 735.3745 | 1468.7344 | 1468.7522 | -12.1 | 0 | 8 | 0.88 | 1Score > 40 indicates identityScore > 20 indicates homology |
DVVNIGIGGSDLGPR + Deamidated (NQ) | |
| 343.1927 | 1026.5563 | 1026.5386 | 17.2 | 0 | 8 | 0.66 | 1Score > 39 indicates identityScore > 18 indicates homology |
LGFTDLFSK | |
| 983.4687 | 1964.9228 | 1964.9327 | -5.01 | 1 | 8 | 0.96 | 1Score > 39 indicates identityScore > 20 indicates homology |
KSQVFSTADDNQPAVSIR + 3 Deamidated (NQ) | |
| 554.2904 | 1659.8494 | 1659.8614 | -7.23 | 1 | 8 | 0.98 | 1Score > 40 indicates identityScore > 20 indicates homology |
GGQLVRAAGTAAQLMAK + 2 Deamidated (NQ); Oxidation (M) | |
| 895.4332 | 1788.8518 | 1788.8433 | 4.78 | 0 | 8 | 0.69 | 1Score > 40 indicates identityScore > 18 indicates homology |
TYTMFFIANYFLDK + Oxidation (M) | |
| 752.4165 | 1502.8184 | 1502.8093 | 6.09 | 1 | 8 | 0.87 | 1Score > 38 indicates identityScore > 20 indicates homology |
ILGQVFIRDVQSE | |
| 418.8836 | 1253.6290 | 1253.6040 | 19.9 | 0 | 8 | 0.95 | 1Score > 40 indicates identityScore > 20 indicates homology |
VYSVAFSPDNR | |
| 497.9286 | 1490.7640 | 1490.7828 | -12.6 | 1 | 8 | 0.98 | 1Score > 41 indicates identityScore > 20 indicates homology |
QNTLATLTKLASTE + Deamidated (NQ) | |
| 730.3746 | 2188.1020 | 2188.1198 | -8.14 | 1 | 8 | 0.45 | 1Score > 39 indicates identityScore > 17 indicates homology |
INAAHGFSLIQVDNTKVTMK + 2 Deamidated (NQ) | |
| 1138.0193 | 2274.0240 | 2274.0521 | -12.3 | 1 | 8 | 0.83 | 1Score > 37 indicates identityScore > 19 indicates homology |
QMSQQMHQAAADLQFELAAR + Deamidated (NQ) | |
| 455.7910 | 909.5674 | 909.5508 | 18.3 | 0 | 8 | 0.97 | 1Score > 32 indicates identityScore > 20 indicates homology |
AALQRPVR | |
| 674.0095 | 2019.0067 | 2019.0421 | -17.5 | 0 | 8 | 0.42 | 1Score > 40 indicates identityScore > 16 indicates homology |
TVQITIMSLIAMTVYFR + Deamidated (NQ); 2 Oxidation (M) | |
| 871.9614 | 1741.9082 | 1741.8934 | 8.55 | 1 | 8 | 0.88 | 1Score > 39 indicates identityScore > 20 indicates homology |
SIPNIMDGWKPGQRK + Oxidation (M) | |
| 852.4501 | 2554.3285 | 2554.3504 | -8.57 | 1 | 8 | 0.26 | 1Score > 36 indicates identityScore > 14 indicates homology |
SGRAIASHQSVLIFDVLSTSDVPR | |
| 685.8866 | 1369.7586 | 1369.7752 | -12.1 | 0 | 8 | 0.94 | 1Score > 39 indicates identityScore > 20 indicates homology |
LVGGVVQMIPVSR + Oxidation (M) | |
| 509.9659 | 1526.8759 | 1526.8854 | -6.26 | 1 | 8 | 0.66 | 1Score > 35 indicates identityScore > 18 indicates homology |
VGLNPVKINTVVMK + Oxidation (M) | |
| 586.3842 | 1756.1308 | 1756.0974 | 19.0 | 1 | 8 | 0.45 | 1Score > 17 indicates identity |
IPIVIVANKADLLHLK |
Not what you expected? Try
the select summary.