MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | Rita3 sp |
| MS data file | : | PRT1270_T-BRSC_3_20250714120051.mgf |
| Database | : | SwissProt 57.15 (515,203 sequences; 181,334,896 residues) |
| Timestamp | : | 12 Aug 2025 at 23:41:29 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | GluC_Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 5,012 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 2778 |
601.6097 | 1801.8073 | 1801.8329 | -14.2 | 1 | 9 | 0.48 | 1Score > 38 indicates identity Score > 18 indicates homology |
QALNGNDNLANAKQQAK + 5 Deamidated (NQ) |
| 3060 |
663.6814 | 1988.0224 | 1988.0214 | 0.48 | 1 | 9 | 0.88 | 1Score > 39 indicates identity Score > 21 indicates homology |
NIAQALFNQDKINDLLR + 3 Deamidated (NQ) |
| 3101 |
1009.5160 | 2017.0174 | 2016.9898 | 13.7 | 1 | 9 | 0.71 | 1Score > 39 indicates identity Score > 20 indicates homology |
SLNQQRLQGQLCDVSIR + 3 Deamidated (NQ) |
| 3546 |
756.0570 | 2265.1492 | 2265.1511 | -0.83 | 1 | 9 | 0.59 | 1Score > 39 indicates identity Score > 19 indicates homology |
RLWVAPSCSLLHSPVDLCR |
| 3714 |
594.0930 | 2372.3429 | 2372.3315 | 4.80 | 1 | 9 | 0.37 | 1Score > 30 indicates identity Score > 17 indicates homology |
VPDTLSPQVPVIEAVLDALGIAR |
| 1992 |
713.8412 | 1425.6678 | 1425.6744 | -4.62 | 0 | 9 | 0.72 | 1Score > 40 indicates identity Score > 20 indicates homology |
HQTALIMPICNE |
| 3127 |
1018.0379 | 2034.0612 | 2034.0382 | 11.3 | 1 | 9 | 0.71 | 1Score > 38 indicates identity Score > 20 indicates homology |
NGSDDAVLAYKLLVQTGNR + Deamidated (NQ) |
| 1742 |
435.2610 | 1302.7612 | 1302.7442 | 13.0 | 1 | 9 | 0.29 | 1Score > 34 indicates identity Score > 16 indicates homology |
LVRSTTVLCVR |
| 3252 |
1057.5896 | 2113.1646 | 2113.1531 | 5.45 | 1 | 9 | 0.45 | 1Score > 34 indicates identity Score > 18 indicates homology |
LVRQLQGDNIVYLNNLLE |
| 3851 |
624.5496 | 2494.1693 | 2494.2009 | -12.7 | 1 | 9 | 0.26 | 1Score > 38 indicates identity Score > 15 indicates homology |
HQAISMVPSEQEPNTVVNVLQR + 3 Deamidated (NQ); Oxidation (M) |
| 1588 |
410.8687 | 1229.5843 | 1229.5751 | 7.49 | 1 | 9 | 0.52 | 1Score > 40 indicates identity Score > 19 indicates homology |
SDPPLCWVEK |
| 2420 |
539.5975 | 1615.7707 | 1615.7916 | -12.9 | 1 | 9 | 0.6 | 1Score > 40 indicates identity Score > 19 indicates homology |
SIFYVSLEDQLMR + Oxidation (M) |
| 2898 |
940.0020 | 1877.9894 | 1878.0098 | -10.9 | 1 | 9 | 0.76 | 1Score > 38 indicates identity Score > 20 indicates homology |
VTEFASLLSNAGIVTTVR + Deamidated (NQ) |
| 218 |
602.3637 | 601.3564 | 601.3548 | 2.78 | 0 | 9 | 0.86 | 1Score > 43 indicates identity Score > 21 indicates homology |
AGVSIR |
| 1342 |
562.8083 | 1123.6020 | 1123.5986 | 3.09 | 0 | 9 | 0.96 | 1Score > 39 indicates identity Score > 21 indicates homology |
SGVGAAHIIDGK |
| 833 |
448.2081 | 894.4016 | 894.4117 | -11.2 | 0 | 9 | 0.48 | 1Score > 41 indicates identity Score > 18 indicates homology |
MTNADLSK + Oxidation (M) |
| 988 |
478.7691 | 955.5236 | 955.5239 | -0.31 | 0 | 9 | 0.87 | 1Score > 39 indicates identity Score > 21 indicates homology |
LFSLPHSR |
| 1465 |
391.5695 | 1171.6867 | 1171.6673 | 16.5 | 1 | 9 | 0.71 | 1Score > 37 indicates identity Score > 20 indicates homology |
ANTGGLSKLVGR |
| 2546 |
558.9855 | 1673.9347 | 1673.9134 | 12.7 | 1 | 9 | 0.28 | 1Score > 36 indicates identity Score > 16 indicates homology |
VSLQNLSMVLRQLR + 2 Deamidated (NQ); Oxidation (M) |
| 2128 |
748.4555 | 1494.8964 | 1494.8770 | 13.0 | 0 | 9 | 0.21 | 1Score > 30 indicates identity Score > 15 indicates homology |
LAADVTGVPTLLVAR |
| 1818 |
446.8758 | 1337.6056 | 1337.6133 | -5.75 | 1 | 9 | 0.76 | 1Score > 40 indicates identity Score > 20 indicates homology |
VMSENTVNSALR + 2 Deamidated (NQ); Oxidation (M) |
| 3345 |
718.3825 | 2152.1257 | 2152.1310 | -2.47 | 1 | 9 | 0.45 | 1Score > 38 indicates identity Score > 18 indicates homology |
QALNSLAQMEPALVRQLPR + 2 Deamidated (NQ); Oxidation (M) |
| 3362 |
541.0253 | 2160.0721 | 2160.0997 | -12.8 | 1 | 9 | 0.55 | 1Score > 39 indicates identity Score > 19 indicates homology |
GISDLAQHYLMRANITAIR + 2 Deamidated (NQ); Oxidation (M) |
| 3593 |
1150.0906 | 2298.1666 | 2298.1300 | 15.9 | 1 | 9 | 0.91 | 1Score > 38 indicates identity Score > 21 indicates homology |
NPENLINDAPIKPTLIGMSNK + 4 Deamidated (NQ); Oxidation (M) |
| 3230 |
525.2567 | 2096.9977 | 2097.0122 | -6.92 | 0 | 9 | 0.56 | 1Score > 39 indicates identity Score > 19 indicates homology |
AMLDSLNIPYVIDTNMVR + Deamidated (NQ); 2 Oxidation (M) |
| 2193 |
381.4389 | 1521.7265 | 1521.7497 | -15.3 | 1 | 9 | 0.71 | 1Score > 41 indicates identity Score > 20 indicates homology |
VVEAGYADPVSLMR + Oxidation (M) |
| 2853 |
617.2756 | 1848.8050 | 1848.7869 | 9.75 | 1 | 9 | 0.2 | 1Score > 37 indicates identity Score > 14 indicates homology |
KMSGHMGAVQQSTQNLE + 4 Deamidated (NQ) |
| 3000 |
972.5471 | 1943.0796 | 1943.0411 | 19.8 | 1 | 9 | 0.3 | 1Score > 34 indicates identity Score > 16 indicates homology |
RNVLVMSFLGDQGLAAPR |
| 3194 |
691.0284 | 2070.0634 | 2070.0415 | 10.5 | 1 | 9 | 0.7 | 1Score > 39 indicates identity Score > 20 indicates homology |
VTKANVVNMHDDIVNVSSK + Deamidated (NQ) |
| 3527 |
751.3667 | 2251.0783 | 2251.0467 | 14.0 | 1 | 9 | 0.23 | 1Score > 39 indicates identity Score > 15 indicates homology |
YAVLSDILGNEDHLGDMDFK |
| 3649 |
776.0327 | 2325.0763 | 2325.0956 | -8.30 | 1 | 9 | 0.96 | 1Score > 38 indicates identity Score > 21 indicates homology |
SILTMMMGVYRDFNITDYR |
| 1814 |
668.8308 | 1335.6470 | 1335.6531 | -4.55 | 1 | 9 | 0.91 | 1Score > 41 indicates identity Score > 21 indicates homology |
TDQYRQVSSPR |
| 957 |
941.4896 | 940.4823 | 940.4978 | -16.4 | 1 | 9 | 0.86 | 1Score > 39 indicates identity Score > 21 indicates homology |
LALENPQR + Deamidated (NQ) |
| 1274 |
1088.5781 | 1087.5708 | 1087.5734 | -2.39 | 1 | 9 | 0.4 | 1Score > 42 indicates identity Score > 17 indicates homology |
GGRSLGSTTPR |
| 2710 |
879.9727 | 1757.9308 | 1757.9022 | 16.3 | 1 | 9 | 0.47 | 1Score > 39 indicates identity Score > 18 indicates homology |
SQFMIRYQIINLSK + 2 Deamidated (NQ); Oxidation (M) |
| 2318 |
315.9950 | 1574.9386 | 1574.9369 | 1.12 | 1 | 9 | 0.83 | 1Score > 29 indicates identity Score > 20 indicates homology |
LVQQRPALPGLARR + Deamidated (NQ) |
| 3553 |
756.3888 | 2266.1446 | 2266.1668 | -9.79 | 0 | 9 | 0.41 | 1Score > 39 indicates identity Score > 17 indicates homology |
LFQIGVAPSSLTLVAVTHMHE + Deamidated (NQ); Oxidation (M) |
| 3443 |
1100.0872 | 2198.1598 | 2198.1214 | 17.5 | 1 | 9 | 0.48 | 1Score > 37 indicates identity Score > 18 indicates homology |
MLGADQPVILQMLEITPALE + Deamidated (NQ); Oxidation (M) |
| 1061 |
496.7818 | 991.5490 | 991.5338 | 15.3 | 1 | 9 | 0.66 | 1Score > 39 indicates identity Score > 19 indicates homology |
TVYKKPQE |
| 2524 |
557.3331 | 1668.9775 | 1668.9774 | 0.061 | 1 | 9 | 0.83 | 1Score > 32 indicates identity Score > 20 indicates homology |
ISVINSLLDNIKAAAK |
| 1792 |
442.5793 | 1324.7161 | 1324.7350 | -14.3 | 1 | 9 | 0.34 | 1Score > 38 indicates identity Score > 16 indicates homology |
AQPLDILNKANK + Deamidated (NQ) |
| 2554 |
562.2955 | 1683.8647 | 1683.8791 | -8.59 | 1 | 9 | 0.87 | 1Score > 40 indicates identity Score > 21 indicates homology |
KALTPVQALSGGQQQR + 3 Deamidated (NQ) |
| 2467 |
821.4220 | 1640.8294 | 1640.8006 | 17.6 | 1 | 9 | 0.5 | 1Score > 40 indicates identity Score > 18 indicates homology |
AVDNGQLQVETVNPR + 2 Deamidated (NQ) |
| 3700 |
787.7569 | 2360.2489 | 2360.2416 | 3.08 | 0 | 9 | 0.41 | 1Score > 36 indicates identity Score > 17 indicates homology |
QTLLAWLDALGWPAPEPGALLE |
| 4216 |
943.8690 | 2828.5852 | 2828.5337 | 18.2 | 1 | 9 | 0.26 | 1Score > 29 indicates identity Score > 15 indicates homology |
DVLLLVHNLPQNLTGHIWYKGQIR + 2 Deamidated (NQ) |
| 1860 |
455.2507 | 1362.7303 | 1362.7368 | -4.76 | 1 | 9 | 0.61 | 1Score > 40 indicates identity Score > 19 indicates homology |
VALRHTNAINPR + 2 Deamidated (NQ) |
| 2801 |
906.0010 | 1809.9874 | 1809.9633 | 13.3 | 0 | 9 | 0.68 | 1Score > 37 indicates identity Score > 19 indicates homology |
TQIPLMLCWALSIHK |
| 3234 |
1051.0083 | 2100.0020 | 2099.9973 | 2.28 | 1 | 9 | 0.89 | 1Score > 39 indicates identity Score > 21 indicates homology |
LPDPPQPSLLPPDPDMLEE + Deamidated (NQ) |
| 3822 |
824.4334 | 2470.2784 | 2470.2349 | 17.6 | 1 | 9 | 0.69 | 1Score > 37 indicates identity Score > 19 indicates homology |
ITSRYTDLQPVGMGAFGLVCSAK |
| 1995 |
714.3959 | 1426.7772 | 1426.7537 | 16.5 | 1 | 9 | 0.79 | 1Score > 39 indicates identity Score > 20 indicates homology |
HMANNIIAMLKR + Oxidation (M) |
| 3061 |
663.6968 | 1988.0686 | 1988.0289 | 20.0 | 1 | 9 | 0.18 | 1Score > 37 indicates identity Score > 14 indicates homology |
QGPMTPLPDVVIIHTPKE + Deamidated (NQ); Oxidation (M) |
| 3743 |
800.0866 | 2397.2380 | 2397.2210 | 7.10 | 0 | 9 | 0.34 | 1Score > 37 indicates identity Score > 16 indicates homology |
AQLMQQVQLGVDALANSTGQPVK + 2 Deamidated (NQ) |
| 2309 |
787.9268 | 1573.8390 | 1573.8464 | -4.66 | 1 | 9 | 0.85 | 1Score > 39 indicates identity Score > 20 indicates homology |
YLNVSPEVLNASIR |
| 3677 |
1175.5817 | 2349.1488 | 2349.1488 | 0.012 | 1 | 9 | 0.99 | 1Score > 39 indicates identity Score > 21 indicates homology |
HVYIVSQNFVNNQLVISSER + 4 Deamidated (NQ) |
| 3220 |
1046.5182 | 2091.0218 | 2091.0129 | 4.30 | 1 | 9 | 0.79 | 1Score > 40 indicates identity Score > 20 indicates homology |
LPQPMQLPHGLSENAMLAE + Oxidation (M) |
| 1157 |
511.7835 | 1021.5524 | 1021.5332 | 18.9 | 0 | 9 | 0.72 | 1Score > 39 indicates identity Score > 20 indicates homology |
DTTFALLLE |
| 3652 |
776.0929 | 2325.2569 | 2325.2250 | 13.7 | 1 | 9 | 0.38 | 1Score > 35 indicates identity Score > 17 indicates homology |
TQTDAALLLPQMIAEALGVTPR + Deamidated (NQ); Oxidation (M) |
| 1506 |
599.3030 | 1196.5914 | 1196.5826 | 7.41 | 0 | 9 | 0.98 | 1Score > 40 indicates identity Score > 21 indicates homology |
DLFGLTNNFR + Deamidated (NQ) |
| 2500 |
833.4651 | 1664.9156 | 1664.9097 | 3.59 | 1 | 9 | 0.8 | 1Score > 37 indicates identity Score > 20 indicates homology |
KSEPNPINAIINNLK + Deamidated (NQ) |
| 2198 |
763.8698 | 1525.7250 | 1525.7446 | -12.8 | 0 | 8 | 0.89 | 1Score > 40 indicates identity Score > 21 indicates homology |
SHMSPNTIIAPITE + Oxidation (M) |
| 3452 |
1103.6416 | 2205.2686 | 2205.2773 | -3.90 | 1 | 8 | 0.83 | 1Score > 29 indicates identity Score > 20 indicates homology |
NVIDQALIKPAKYVPITPPK + Deamidated (NQ) |
| 3623 |
770.7757 | 2309.3053 | 2309.2995 | 2.51 | 1 | 8 | 0.49 | 1Score > 31 indicates identity Score > 18 indicates homology |
FGPIIQTGDGLLLLKQVQPSGK + Deamidated (NQ) |
| 1441 |
583.3296 | 1164.6446 | 1164.6615 | -14.5 | 1 | 8 | 0.85 | 1Score > 38 indicates identity Score > 20 indicates homology |
ARHILVTINE |
| 2516 |
834.4549 | 1666.8952 | 1666.9076 | -7.41 | 1 | 8 | 0.17 | 1Score > 38 indicates identity Score > 13 indicates homology |
LAMLQLTHNKLLQE + Oxidation (M) |
| 165 |
516.3160 | 515.3087 | 515.3067 | 3.87 | 1 | 8 | 0.79 | 1Score > 47 indicates identity Score > 20 indicates homology |
KGSPK |
| 1903 |
347.4503 | 1385.7721 | 1385.7779 | -4.21 | 1 | 8 | 0.59 | 1Score > 38 indicates identity Score > 19 indicates homology |
LPQVRVLDYQR |
| 1963 |
472.2664 | 1413.7774 | 1413.7715 | 4.15 | 0 | 8 | 0.95 | 1Score > 39 indicates identity Score > 21 indicates homology |
GSDLLVNIDIDLK |
| 3030 |
986.5336 | 1971.0526 | 1971.0248 | 14.1 | 1 | 8 | 0.96 | 1Score > 38 indicates identity Score > 21 indicates homology |
IMAVVKANGYGHGLLNVAE + Oxidation (M) |
| 2084 |
737.8723 | 1473.7300 | 1473.7061 | 16.2 | 0 | 8 | 0.51 | 1Score > 41 indicates identity Score > 18 indicates homology |
VSPYDPLDLQMVP + Deamidated (NQ) |
| 2854 |
925.4539 | 1848.8932 | 1848.9026 | -5.08 | 1 | 8 | 0.78 | 1Score > 40 indicates identity Score > 20 indicates homology |
GQLSSVTAVLQEMNLLE + 2 Deamidated (NQ); Oxidation (M) |
| 1372 |
380.2009 | 1137.5809 | 1137.5666 | 12.6 | 1 | 8 | 0.87 | 1Score > 41 indicates identity Score > 20 indicates homology |
KDHAVQPLTE + Deamidated (NQ) |
| 3351 |
1078.1045 | 2154.1944 | 2154.2194 | -11.6 | 1 | 8 | 0.54 | 1Score > 33 indicates identity Score > 18 indicates homology |
RVSNLVPMTIIGAASNLIIR + Deamidated (NQ); Oxidation (M) |
| 3001 |
649.7075 | 1946.1007 | 1946.0625 | 19.6 | 1 | 8 | 0.36 | 1Score > 33 indicates identity Score > 16 indicates homology |
IGPVSDVLRQLFALFDR + Deamidated (NQ) |
| 3512 |
749.0549 | 2244.1429 | 2244.1386 | 1.90 | 0 | 8 | 0.39 | 1Score > 39 indicates identity Score > 17 indicates homology |
AQPAGPTAQPGGTAPGLAALQALGE + Deamidated (NQ) |
| 1863 |
456.2160 | 1365.6262 | 1365.6466 | -15.0 | 1 | 8 | 0.55 | 1Score > 40 indicates identity Score > 18 indicates homology |
WPFDKFQGADR |
| 2099 |
739.3539 | 1476.6932 | 1476.7018 | -5.76 | 1 | 8 | 0.72 | 1Score > 40 indicates identity Score > 20 indicates homology |
QMTLVLEAQQLGE + 2 Deamidated (NQ); Oxidation (M) |
| 2602 |
855.4191 | 1708.8236 | 1708.8301 | -3.80 | 1 | 8 | 0.62 | 1Score > 41 indicates identity Score > 19 indicates homology |
QMSQQNLTKQTGLSK + 2 Deamidated (NQ); Oxidation (M) |
| 3233 |
1050.5619 | 2099.1092 | 2099.0899 | 9.24 | 1 | 8 | 0.76 | 1Score > 37 indicates identity Score > 20 indicates homology |
VLSLLNDVGSGIQYLHENK + Deamidated (NQ) |
| 2696 |
876.4315 | 1750.8484 | 1750.8573 | -5.06 | 1 | 8 | 0.91 | 1Score > 41 indicates identity Score > 20 indicates homology |
ARFHDAMNILGPQHK + Deamidated (NQ); Oxidation (M) |
| 3439 |
733.3659 | 2197.0759 | 2197.0434 | 14.8 | 0 | 8 | 0.86 | 1Score > 39 indicates identity Score > 20 indicates homology |
DHTKPVQQVLADMTNGGVDR + Deamidated (NQ); Oxidation (M) |
| 2425 |
810.4219 | 1618.8292 | 1618.8031 | 16.1 | 1 | 8 | 0.36 | 1Score > 40 indicates identity Score > 16 indicates homology |
KNSFFFPYGVNIGK + 2 Deamidated (NQ) |
| 4378 |
1004.8800 | 3011.6182 | 3011.5750 | 14.3 | 1 | 8 | 1 | 1Score > 33 indicates identity Score > 21 indicates homology |
LLNQGGLFVLTGASAALNRTSGMIAYGATK + Deamidated (NQ); Oxidation (M) |
| 2568 |
564.9894 | 1691.9464 | 1691.9206 | 15.2 | 0 | 8 | 0.56 | 1Score > 35 indicates identity Score > 18 indicates homology |
TVTTGNPVRPPVLAAAE |
| 2034 |
482.6028 | 1444.7866 | 1444.8051 | -12.9 | 1 | 8 | 0.93 | 1Score > 39 indicates identity Score > 21 indicates homology |
LRVLHGHSNWVK |
| 2545 |
558.9852 | 1673.9338 | 1673.9577 | -14.3 | 1 | 8 | 0.91 | 1Score > 36 indicates identity Score > 20 indicates homology |
VAIRHVAPVSLQDLR + Deamidated (NQ) |
| 2894 |
625.9719 | 1874.8939 | 1874.9110 | -9.12 | 1 | 8 | 0.63 | 1Score > 40 indicates identity Score > 19 indicates homology |
QIEVTTDGAGVSGTVVDVE |
| 1418 |
578.3038 | 1154.5930 | 1154.6084 | -13.3 | 0 | 8 | 0.96 | 1Score > 40 indicates identity Score > 21 indicates homology |
GNIYVYASLR |
| 2711 |
586.9846 | 1757.9320 | 1757.9159 | 9.14 | 1 | 8 | 0.53 | 1Score > 39 indicates identity Score > 18 indicates homology |
IARLQNVLDLTGSDNK + 2 Deamidated (NQ) |
| 3017 |
654.6541 | 1960.9405 | 1960.9412 | -0.36 | 1 | 8 | 0.57 | 1Score > 40 indicates identity Score > 18 indicates homology |
VNGGLLVQDRDLGMVTAGE + 2 Deamidated (NQ); Oxidation (M) |
| 1414 |
578.3000 | 1154.5854 | 1154.6084 | -19.9 | 0 | 8 | 0.49 | 1Score > 40 indicates identity Score > 18 indicates homology |
GNIYVYASLR |
| 3706 |
788.1188 | 2361.3346 | 2361.3743 | -16.8 | 1 | 8 | 0.36 | 1Score > 30 indicates identity Score > 16 indicates homology |
NIRLSVAAIVTDVLPNGNLIIR + Deamidated (NQ) |
| 1676 |
637.3342 | 1272.6538 | 1272.6786 | -19.5 | 1 | 8 | 0.93 | 1Score > 42 indicates identity Score > 20 indicates homology |
RAVVNDLAGTTR + Deamidated (NQ) |
| 2757 |
596.3293 | 1785.9661 | 1785.9910 | -14.0 | 1 | 8 | 0.54 | 1Score > 38 indicates identity Score > 18 indicates homology |
SAGKGMPVLLLTALGTIE + Oxidation (M) |
| 3357 |
1081.0403 | 2160.0660 | 2160.0305 | 16.5 | 1 | 8 | 0.53 | 1Score > 39 indicates identity Score > 18 indicates homology |
MAPQIDYTMMVFKPIAEK + 3 Oxidation (M) |
| 425 |
710.3892 | 709.3819 | 709.3871 | -7.32 | 0 | 8 | 0.31 | 1Score > 37 indicates identity Score > 16 indicates homology |
IGDHIR |
| 2250 |
775.3806 | 1548.7466 | 1548.7267 | 12.9 | 1 | 8 | 0.86 | 1Score > 41 indicates identity Score > 20 indicates homology |
GTDNSNDAIKSALNK + 2 Deamidated (NQ) |
| 3290 |
1064.6145 | 2127.2144 | 2127.1728 | 19.6 | 1 | 8 | 0.24 | 1Score > 30 indicates identity Score > 15 indicates homology |
LAALGNIYVNDQAPWKLLK + Deamidated (NQ) |
| 2797 |
603.9520 | 1808.8342 | 1808.8033 | 17.1 | 1 | 8 | 0.61 | 1Score > 40 indicates identity Score > 19 indicates homology |
QAITSAGSGCMAALDAER + Deamidated (NQ) |
| 2539 |
558.6191 | 1672.8355 | 1672.8460 | -6.32 | 1 | 8 | 0.63 | 1Score > 41 indicates identity Score > 19 indicates homology |
GYNAVYFKAALSGALE |
| 2566 |
846.4769 | 1690.9392 | 1690.9155 | 14.1 | 0 | 8 | 0.44 | 1Score > 35 indicates identity Score > 17 indicates homology |
ILQLAGQPFDHSPIR |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/