| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | Rita3 sp |
| MS data file | : | PRT1270_T-BRSC_3_20250714120051.mgf |
| Database | : | SwissProt 57.15 (515,203 sequences; 181,334,896 residues) |
| Timestamp | : | 12 Aug 2025 at 23:41:29 GMT |
Not what you expected? Try
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | GluC_Trypsin |
| Fixed modifications | : | |
| Variable modifications | : | |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 5,012 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 | 2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | ||||
| 6.2e-007 | 1 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | ||||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle (
) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 752.3910 | 1502.7674 | 1502.7477 | 13.1 | 1 | 10 | 0.92 | 1Score > 41 indicates identityScore > 22 indicates homology |
NSIHSIYTELNGR | |
| 648.0267 | 1941.0583 | 1941.0836 | -13.0 | 0 | 10 | 0.99 | 1Score > 36 indicates identityScore > 22 indicates homology |
AIILVSLPFNASWLNQR | |
| 733.3934 | 2197.1584 | 2197.1338 | 11.2 | 1 | 10 | 0.35 | 1Score > 37 indicates identityScore > 18 indicates homology |
SLTSAQLQRLTNLHGAASLSE + Deamidated (NQ) | |
| 1128.6194 | 2255.2242 | 2255.2426 | -8.14 | 1 | 10 | 0.74 | 1Score > 35 indicates identityScore > 21 indicates homology |
KPLSEISFGHVLLNLFNTAR | |
| 458.2670 | 1371.7792 | 1371.7609 | 13.3 | 1 | 10 | 0.82 | 1Score > 37 indicates identityScore > 21 indicates homology |
QAVELSALLAQTK + Deamidated (NQ) | |
| 812.4273 | 1622.8400 | 1622.8416 | -0.97 | 0 | 10 | 0.72 | 1Score > 40 indicates identityScore > 21 indicates homology |
HGVQLNAPAAFQLVR + 3 Deamidated (NQ) | |
| 384.1886 | 1149.5440 | 1149.5410 | 2.62 | 1 | 10 | 0.94 | 1Score > 42 indicates identityScore > 22 indicates homology |
KSGMIPLQME + Deamidated (NQ); Oxidation (M) | |
| 750.4086 | 1498.8026 | 1498.7814 | 14.2 | 1 | 10 | 0.32 | 1Score > 39 indicates identityScore > 17 indicates homology |
DGKTPIQLVQMPR + Deamidated (NQ); Oxidation (M) | |
| 392.4604 | 1565.8125 | 1565.8236 | -7.07 | 0 | 10 | 0.56 | 1Score > 40 indicates identityScore > 20 indicates homology |
IVVGMSGASGAIYGIR + Oxidation (M) | |
| 657.3699 | 1969.0879 | 1969.0745 | 6.78 | 0 | 10 | 0.64 | 1Score > 35 indicates identityScore > 20 indicates homology |
TVNIPSYQVRPGDVVAVR | |
| 961.1341 | 2880.3805 | 2880.3851 | -1.61 | 1 | 10 | 0.38 | 1Score > 37 indicates identityScore > 18 indicates homology |
TAINAPNNYQVAVQIFDGKTSLCEPK + 3 Deamidated (NQ) | |
| 453.7519 | 905.4892 | 905.4858 | 3.80 | 1 | 10 | 0.9 | 1Score > 41 indicates identityScore > 22 indicates homology |
AADEFLLK | |
| 505.2170 | 1008.4194 | 1008.4070 | 12.4 | 1 | 10 | 0.88 | 1Score > 39 indicates identityScore > 22 indicates homology |
NVEAQNGMK + 3 Deamidated (NQ); Oxidation (M) | |
| 863.4486 | 862.4413 | 862.4470 | -6.59 | 0 | 10 | 0.55 | 1Score > 42 indicates identityScore > 19 indicates homology |
TGVLITME | |
| 609.8651 | 1217.7156 | 1217.7019 | 11.3 | 0 | 10 | 0.95 | 1Score > 34 indicates identityScore > 22 indicates homology |
FSLANLAIQIK + Deamidated (NQ) | |
| 427.7368 | 1706.9181 | 1706.8879 | 17.7 | 1 | 10 | 0.67 | 1Score > 38 indicates identityScore > 20 indicates homology |
GLNPYKLVINQTAFE + Deamidated (NQ) | |
| 318.6908 | 635.3670 | 635.3676 | -0.89 | 1 | 10 | 0.76 | 1Score > 39 indicates identityScore > 21 indicates homology |
MTKIK + Oxidation (M) | |
| 1170.6028 | 2339.1910 | 2339.1757 | 6.57 | 1 | 10 | 0.9 | 1Score > 38 indicates identityScore > 22 indicates homology |
LYTNVRPEASYNQSLSILDR + Deamidated (NQ) | |
| 608.9922 | 1823.9548 | 1823.9417 | 7.14 | 1 | 10 | 1 | 1Score > 38 indicates identityScore > 22 indicates homology |
TAQKLAFQAAVSDAFQK + Deamidated (NQ) | |
| 679.3928 | 2035.1566 | 2035.1605 | -1.93 | 1 | 10 | 0.53 | 1Score > 31 indicates identityScore > 19 indicates homology |
VQLVLPLLVAEAAAAPAFLE + Deamidated (NQ) | |
| 872.4658 | 1742.9170 | 1742.9090 | 4.59 | 1 | 10 | 0.71 | 1Score > 39 indicates identityScore > 21 indicates homology |
ELQTVIYHPNLSTVK + 2 Deamidated (NQ) | |
| 384.2132 | 1149.6178 | 1149.6142 | 3.07 | 1 | 10 | 0.97 | 1Score > 40 indicates identityScore > 22 indicates homology |
KGTVITFGDGR | |
| 979.5121 | 978.5048 | 978.5242 | -19.8 | 0 | 10 | 0.55 | 1Score > 41 indicates identityScore > 19 indicates homology |
SILMLGAMK + Oxidation (M) | |
| 379.8907 | 1136.6503 | 1136.6441 | 5.41 | 1 | 10 | 0.6 | 1Score > 36 indicates identityScore > 20 indicates homology |
KFSDSIITVK | |
| 710.3811 | 1418.7476 | 1418.7228 | 17.5 | 0 | 10 | 0.86 | 1Score > 40 indicates identityScore > 21 indicates homology |
TTGTPVSMVVWNK | |
| 715.8701 | 1429.7256 | 1429.7412 | -10.9 | 1 | 10 | 0.8 | 1Score > 41 indicates identityScore > 21 indicates homology |
ANSINSKLNILNE + Deamidated (NQ) | |
| 884.4381 | 1766.8616 | 1766.8435 | 10.3 | 1 | 10 | 0.47 | 1Score > 40 indicates identityScore > 19 indicates homology |
LQHSGSTNKQQQSPPK + 3 Deamidated (NQ) | |
| 995.5157 | 994.5084 | 994.5196 | -11.2 | 0 | 9 | 0.65 | 1Score > 41 indicates identityScore > 20 indicates homology |
IGHTISDPR | |
| 760.0062 | 2276.9968 | 2277.0132 | -7.19 | 1 | 9 | 0.38 | 1Score > 36 indicates identityScore > 18 indicates homology |
LTTQAQNVVAEAQAQATSAGNAE + 5 Deamidated (NQ) | |
| 639.3710 | 1276.7274 | 1276.7101 | 13.6 | 0 | 9 | 0.35 | 1Score > 36 indicates identityScore > 17 indicates homology |
MLQVLIYIVGE | |
| 939.5164 | 2815.5274 | 2815.5153 | 4.29 | 1 | 9 | 1 | 1Score > 33 indicates identityScore > 22 indicates homology |
IINGGLTLMNVKNIIIHNINIHDVK + 4 Deamidated (NQ); Oxidation (M) | |
| 964.8893 | 2891.6461 | 2891.5949 | 17.7 | 1 | 9 | 1 | 1Score > 27 indicates identityScore > 22 indicates homology |
QLFLYKVTIPALASQNPAIHPFTPPK + Deamidated (NQ) | |
| 757.3882 | 756.3809 | 756.3766 | 5.73 | 1 | 9 | 0.71 | 1Score > 38 indicates identityScore > 20 indicates homology |
NGIPAER + Deamidated (NQ) | |
| 469.7344 | 937.4542 | 937.4393 | 16.0 | 0 | 9 | 0.94 | 1Score > 41 indicates identityScore > 22 indicates homology |
YSQLQGIE + Deamidated (NQ) | |
| 426.9737 | 1703.8657 | 1703.8777 | -7.05 | 1 | 9 | 0.34 | 1Score > 41 indicates identityScore > 17 indicates homology |
QGAIIMHPAPVNRGVE + Oxidation (M) | |
| 712.7105 | 2135.1097 | 2135.0687 | 19.2 | 0 | 9 | 0.82 | 1Score > 38 indicates identityScore > 21 indicates homology |
AQWFTIQHIQPSPLQPNK + 3 Deamidated (NQ) | |
| 825.7653 | 2474.2741 | 2474.2522 | 8.83 | 1 | 9 | 0.96 | 1Score > 38 indicates identityScore > 22 indicates homology |
MPITQQMHAILHQGKSPSDAIR + Oxidation (M) | |
| 446.2581 | 1335.7525 | 1335.7663 | -10.3 | 1 | 9 | 1 | 1Score > 36 indicates identityScore > 22 indicates homology |
LLLFLDAYRGR | |
| 665.6497 | 1993.9273 | 1993.9231 | 2.12 | 1 | 9 | 0.43 | 1Score > 39 indicates identityScore > 18 indicates homology |
TVISSSMFFPLYETLNE + Deamidated (NQ); Oxidation (M) | |
| 705.3418 | 1408.6690 | 1408.6656 | 2.41 | 1 | 9 | 0.96 | 1Score > 41 indicates identityScore > 22 indicates homology |
EMVQAIVDYQGR + Deamidated (NQ) | |
| 831.4284 | 2491.2634 | 2491.3006 | -14.9 | 1 | 9 | 0.45 | 1Score > 38 indicates identityScore > 18 indicates homology |
TPQTLVGGPVAMQRWLRPPDVR + 2 Deamidated (NQ); Oxidation (M) | |
| 986.0229 | 1970.0312 | 1970.0255 | 2.93 | 1 | 9 | 0.89 | 1Score > 38 indicates identityScore > 21 indicates homology |
TSQQIILNGQAVRMPDAK + Deamidated (NQ) | |
| 718.7170 | 2153.1292 | 2153.1633 | -15.8 | 0 | 9 | 0.32 | 1Score > 38 indicates identityScore > 17 indicates homology |
RPQIQTIAPGAQIAHFLYK + 2 Deamidated (NQ) | |
| 833.9930 | 1665.9714 | 1665.9413 | 18.1 | 1 | 9 | 0.19 | 1Score > 32 indicates identityScore > 15 indicates homology |
QQLINLDQVNKKPK + Deamidated (NQ) | |
| 402.8579 | 1205.5519 | 1205.5598 | -6.56 | 1 | 9 | 0.55 | 1Score > 40 indicates identityScore > 19 indicates homology |
DLIEAMDDLR + Oxidation (M) | |
| 442.9140 | 1325.7202 | 1325.7092 | 8.29 | 1 | 9 | 0.55 | 1Score > 39 indicates identityScore > 19 indicates homology |
TVGTASAFFAKAR | |
| 427.5928 | 1279.7566 | 1279.7500 | 5.17 | 1 | 9 | 0.93 | 1Score > 34 indicates identityScore > 22 indicates homology |
SVHDILINLKK + Deamidated (NQ) | |
| 832.9202 | 3327.6517 | 3327.6626 | -3.29 | 1 | 9 | 0.56 | 1Score > 35 indicates identityScore > 19 indicates homology |
QCVYIRFDMLVMAIGGMIALINPTNNIIK + 4 Deamidated (NQ); Oxidation (M) | |
| 705.6987 | 2114.0743 | 2114.0756 | -0.62 | 1 | 9 | 0.48 | 1Score > 39 indicates identityScore > 19 indicates homology |
LTNSIIWNSPNVSINRQR + 3 Deamidated (NQ) | |
| 806.4193 | 2416.2361 | 2416.2611 | -10.4 | 1 | 9 | 0.52 | 1Score > 38 indicates identityScore > 19 indicates homology |
GYDAPRPGLDFRLLITGGSQGAR | |
| 515.9443 | 1544.8111 | 1544.7868 | 15.7 | 1 | 9 | 0.83 | 1Score > 40 indicates identityScore > 21 indicates homology |
RMTLSGQLEPTLAE | |
| 336.1983 | 670.3820 | 670.3762 | 8.72 | 0 | 9 | 0.51 | 1Score > 35 indicates identityScore > 19 indicates homology |
AGLPSAR | |
| 712.7120 | 2135.1142 | 2135.0833 | 14.4 | 1 | 9 | 0.38 | 1Score > 38 indicates identityScore > 18 indicates homology |
LVHHDIIDALENMSRPFK + Deamidated (NQ) | |
| 1058.5381 | 2115.0616 | 2115.0592 | 1.17 | 0 | 9 | 0.57 | 1Score > 39 indicates identityScore > 19 indicates homology |
TAIIDPTDMLSMPLPSGNVK + Oxidation (M) | |
| 534.2763 | 1599.8071 | 1599.8216 | -9.11 | 1 | 9 | 0.72 | 1Score > 40 indicates identityScore > 20 indicates homology |
ATVSQTISTEIASHR | |
| 1061.5258 | 3181.5556 | 3181.5682 | -3.97 | 1 | 9 | 1 | 1Score > 36 indicates identityScore > 22 indicates homology |
LAMHGTHNMLNSLAAIGVATQMGIADDKIR + Deamidated (NQ); 2 Oxidation (M) | |
| 406.5696 | 1216.6870 | 1216.6928 | -4.79 | 1 | 9 | 0.5 | 1Score > 38 indicates identityScore > 19 indicates homology |
KHPDNVVPALK | |
| 1030.5348 | 2059.0550 | 2059.0545 | 0.26 | 1 | 9 | 0.82 | 1Score > 39 indicates identityScore > 21 indicates homology |
IVSSQINSGNALSADVQKAR + 2 Deamidated (NQ) | |
| 769.7367 | 2306.1883 | 2306.1729 | 6.66 | 1 | 9 | 0.37 | 1Score > 38 indicates identityScore > 17 indicates homology |
FTKMHGLGNDFVVLDLISQR + Deamidated (NQ); Oxidation (M) | |
| 864.4917 | 1726.9688 | 1726.9352 | 19.5 | 1 | 9 | 0.65 | 1Score > 36 indicates identityScore > 20 indicates homology |
AIIDAILAIQDKISNE + Deamidated (NQ) | |
| 489.6165 | 1465.8277 | 1465.8253 | 1.65 | 1 | 9 | 0.51 | 1Score > 36 indicates identityScore > 19 indicates homology |
QLHQRVSVILGSK + 2 Deamidated (NQ) | |
| 859.4423 | 3433.7401 | 3433.7360 | 1.19 | 1 | 9 | 0.19 | 1Score > 35 indicates identityScore > 15 indicates homology |
AVGTGTSLALSSLLSLLLFAGMQMYSRQLASTE + 2 Deamidated (NQ); Oxidation (M) | |
| 395.7280 | 789.4414 | 789.4385 | 3.76 | 0 | 9 | 0.6 | 1Score > 40 indicates identityScore > 19 indicates homology |
SPLFAGAK | |
| 1068.0969 | 2134.1792 | 2134.1422 | 17.4 | 1 | 9 | 0.9 | 1Score > 34 indicates identityScore > 21 indicates homology |
KQILIEPVSAQWIQSAHGK + 2 Deamidated (NQ) | |
| 569.8068 | 1137.5990 | 1137.6070 | -7.00 | 0 | 9 | 0.62 | 1Score > 40 indicates identityScore > 20 indicates homology |
ADFFLLDGIK | |
| 793.3593 | 1584.7040 | 1584.7016 | 1.55 | 0 | 9 | 0.71 | 1Score > 39 indicates identityScore > 20 indicates homology |
VGSNSQDGDATPSPPR + Deamidated (NQ) | |
| 600.3356 | 1797.9850 | 1797.9837 | 0.73 | 0 | 9 | 0.16 | 1Score > 36 indicates identityScore > 14 indicates homology |
VTVSTSGVVPALDILGDR | |
| 501.2628 | 2001.0221 | 2000.9976 | 12.2 | 1 | 9 | 0.72 | 1Score > 39 indicates identityScore > 20 indicates homology |
QLMELDTSPSPSAQVVGLK + 2 Deamidated (NQ) | |
| 798.4111 | 1594.8076 | 1594.7951 | 7.89 | 0 | 9 | 0.6 | 1Score > 40 indicates identityScore > 19 indicates homology |
QQLANLTHLNDAQK + 2 Deamidated (NQ) | |
| 905.9919 | 1809.9692 | 1809.9724 | -1.72 | 1 | 9 | 0.75 | 1Score > 38 indicates identityScore > 20 indicates homology |
DPAIRNVIVLQTVLQE + 3 Deamidated (NQ) | |
| 746.3914 | 2236.1524 | 2236.1232 | 13.1 | 0 | 9 | 0.79 | 1Score > 38 indicates identityScore > 21 indicates homology |
AIIATVLQMLMGGGGSFSAGGPGK + Deamidated (NQ); Oxidation (M) | |
| 826.0746 | 2475.2020 | 2475.2113 | -3.76 | 0 | 9 | 0.51 | 1Score > 38 indicates identityScore > 19 indicates homology |
SFVYGTGCGLGWMLAIISMAGLR + Oxidation (M) | |
| 665.3533 | 1993.0381 | 1993.0561 | -9.03 | 1 | 9 | 0.53 | 1Score > 38 indicates identityScore > 19 indicates homology |
IIPKYDYVVLNGPAGVFE | |
| 522.6483 | 2608.2051 | 2608.2380 | -12.6 | 0 | 9 | 0.28 | 1Score > 37 indicates identityScore > 16 indicates homology |
SNRPPMGWPSLTNSNHTPPIIFE + Deamidated (NQ); Oxidation (M) | |
| 887.4678 | 1772.9210 | 1772.8866 | 19.4 | 0 | 9 | 0.61 | 1Score > 40 indicates identityScore > 19 indicates homology |
LNTILNTMSTIYSTGK + Deamidated (NQ); Oxidation (M) | |
| 944.4391 | 1886.8636 | 1886.8720 | -4.43 | 1 | 9 | 0.95 | 1Score > 39 indicates identityScore > 21 indicates homology |
DDICVFISEHNPAQIK + 2 Deamidated (NQ) | |
| 809.3979 | 1616.7812 | 1616.8046 | -14.5 | 1 | 9 | 0.45 | 1Score > 40 indicates identityScore > 18 indicates homology |
IYVKHTGQDLDTVE | |
| 366.4663 | 1461.8361 | 1461.8113 | 17.0 | 1 | 9 | 0.91 | 1Score > 35 indicates identityScore > 21 indicates homology |
MTVLTQEAIITVK + Oxidation (M) | |
| 564.3451 | 1126.6756 | 1126.6710 | 4.13 | 0 | 9 | 0.69 | 1Score > 36 indicates identityScore > 20 indicates homology |
ITLQGINIVR + Deamidated (NQ) | |
| 592.3506 | 1182.6866 | 1182.6873 | -0.57 | 1 | 9 | 0.58 | 1Score > 37 indicates identityScore > 19 indicates homology |
HLLVPRGTYK | |
| 594.6810 | 1781.0212 | 1781.0159 | 2.94 | 1 | 9 | 0.15 | 1Score > 32 indicates identityScore > 13 indicates homology |
RLGLGLQGSVQVLPSTR + Deamidated (NQ) | |
| 644.3698 | 1930.0876 | 1930.0847 | 1.47 | 1 | 9 | 0.4 | 1Score > 33 indicates identityScore > 18 indicates homology |
IASSGSVLVSGRLLSDITR | |
| 724.8915 | 2895.5369 | 2895.5454 | -2.94 | 1 | 9 | 0.47 | 1Score > 34 indicates identityScore > 18 indicates homology |
TPHIQNLAVGGVANPINLDGLGVLNLER + 2 Deamidated (NQ) | |
| 365.5259 | 1093.5559 | 1093.5404 | 14.2 | 0 | 9 | 0.93 | 1Score > 41 indicates identityScore > 21 indicates homology |
NSYLIDNVR + Deamidated (NQ) | |
| 944.5095 | 1887.0044 | 1887.0102 | -3.03 | 1 | 9 | 0.96 | 1Score > 38 indicates identityScore > 21 indicates homology |
FGRLVQLQTLILQDNE + Deamidated (NQ) | |
| 755.4089 | 1508.8032 | 1508.8021 | 0.76 | 1 | 9 | 0.54 | 1Score > 39 indicates identityScore > 19 indicates homology |
APLHETLLDMVVR + Oxidation (M) | |
| 678.3282 | 677.3209 | 677.3166 | 6.31 | 0 | 9 | 0.7 | 1Score > 41 indicates identityScore > 20 indicates homology |
LMGDAR + Oxidation (M) | |
| 508.2937 | 1014.5728 | 1014.5709 | 1.88 | 1 | 9 | 0.75 | 1Score > 41 indicates identityScore > 20 indicates homology |
VLEQLIGSR + Deamidated (NQ) | |
| 746.4081 | 2236.2025 | 2236.2038 | -0.60 | 1 | 9 | 0.2 | 1Score > 36 indicates identityScore > 14 indicates homology |
KVNSAVFPGLQGGPLMHVIAGK + Deamidated (NQ); Oxidation (M) | |
| 885.7870 | 2654.3392 | 2654.2931 | 17.3 | 1 | 9 | 0.26 | 1Score > 37 indicates identityScore > 16 indicates homology |
VQADYMGMLATVINSLALQDALER + Deamidated (NQ); 2 Oxidation (M) | |
| 544.2697 | 2173.0497 | 2173.0474 | 1.07 | 1 | 9 | 0.88 | 1Score > 39 indicates identityScore > 21 indicates homology |
YRVTLDNGVVVGAYASGQMR + 2 Deamidated (NQ); Oxidation (M) | |
| 953.0218 | 1904.0290 | 1904.0255 | 1.88 | 1 | 9 | 0.7 | 1Score > 37 indicates identityScore > 20 indicates homology |
DIAKVAPANTAVQVIAPPE + Deamidated (NQ) | |
| 836.4700 | 1670.9254 | 1670.9025 | 13.7 | 1 | 9 | 0.51 | 1Score > 37 indicates identityScore > 19 indicates homology |
NIIPLSDMTVVRADK | |
| 758.0974 | 2271.2704 | 2271.2699 | 0.21 | 1 | 9 | 0.16 | 1Score > 32 indicates identityScore > 14 indicates homology |
GINIVTKHNKPTANVPNGGIVK + Deamidated (NQ) | |
| 690.3369 | 1378.6592 | 1378.6737 | -10.5 | 0 | 9 | 0.78 | 1Score > 41 indicates identityScore > 20 indicates homology |
NISGVVMHMTFK + Oxidation (M) | |
| 946.4803 | 1890.9460 | 1890.9218 | 12.8 | 1 | 9 | 0.9 | 1Score > 40 indicates identityScore > 21 indicates homology |
DDVAASMALRIAGSSGQAR + Oxidation (M) | |
| 787.0750 | 2358.2032 | 2358.1676 | 15.1 | 1 | 9 | 0.18 | 1Score > 38 indicates identityScore > 14 indicates homology |
AGAATPRTAPGHSTPAVTGANQPAR + 2 Deamidated (NQ) | |
| 1068.0288 | 2134.0430 | 2134.0039 | 18.3 | 1 | 9 | 0.44 | 1Score > 40 indicates identityScore > 18 indicates homology |
QVDSSSVLHNASTRFSDGAR + Deamidated (NQ) | |
| 744.3752 | 2230.1038 | 2230.1450 | -18.5 | 1 | 9 | 0.41 | 1Score > 39 indicates identityScore > 18 indicates homology |
AIIDTALSGRDCLVVMPTGGGK | |
| 663.0624 | 2648.2205 | 2648.2429 | -8.44 | 0 | 9 | 0.79 | 1Score > 37 indicates identityScore > 20 indicates homology |
VGAVDMTQHQSVGGPYNVQGFPTLK + 3 Deamidated (NQ); Oxidation (M) |
Not what you expected? Try
the select summary.