MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita3 sp
MS data file : PRT1270_T-BRSC_3_20250714120051.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:41:29 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 5,012

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1201–1300 (out of 3956)

Page: Previous 1 …8 9 10 11 12 13 14 15 16 17 18 … 40 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2075 735.3642 1468.7138 1468.7270 -8.96 1 12 0.39 +1Score > 41 indicates identity
Score > 20 indicates homology		 TTKGAPVATNHQSR + 2 Deamidated (NQ)
2508 556.3151 1665.9235 1665.9375 -8.42 0 12 0.41 +1Score > 36 indicates identity
Score > 20 indicates homology		 SMPPAVLAGQIIDLLK + Deamidated (NQ)
1193 346.8708 1037.5906 1037.5869 3.50 0 12 0.48 +1Score > 35 indicates identity
Score > 21 indicates homology		 QLLSVDVHK
3486 1116.5930 2231.1714 2231.1296 18.7 1 12 0.32 +1Score > 37 indicates identity
Score > 19 indicates homology		 ELQWLLNMIQTDPVPYVR + Deamidated (NQ); Oxidation (M)
1382 570.3304 1138.6462 1138.6386 6.69 0 12 0.44 +1Score > 36 indicates identity
Score > 21 indicates homology		 QGPLWALLLE
3241 703.0414 2106.1024 2106.0898 5.97 1 12 0.31 +1Score > 38 indicates identity
Score > 19 indicates homology		 QADVALIWYFTRPQLER + Deamidated (NQ)
3471 1111.5234 2221.0322 2220.9923 18.0 1 12 0.48 +1Score > 38 indicates identity
Score > 21 indicates homology		 NSSGWWDGLVIDDSNGKVNR + 3 Deamidated (NQ)
2489 828.4831 1654.9516 1654.9215 18.2 1 12 0.29 +1Score > 34 indicates identity
Score > 19 indicates homology		 QMLLEGLDPIALTLK + Deamidated (NQ)
3221 698.0150 2091.0232 2091.0133 4.70 1 12 0.62 +1Score > 40 indicates identity
Score > 22 indicates homology		 LTQNGFRNNATIDQWNAK + Deamidated (NQ)
3769 605.3242 2417.2677 2417.2737 -2.47 0 12 0.17 +1Score > 37 indicates identity
Score > 16 indicates homology		 LNHVGLPGGKPSALDNGMATIVVR + 2 Deamidated (NQ)
1604 412.5701 1234.6885 1234.6744 11.4 0 12 0.75 +1Score > 37 indicates identity
Score > 23 indicates homology		 QLCLPLHILE
2667 871.4665 1740.9184 1740.9080 6.00 1 12 0.78 +1Score > 39 indicates identity
Score > 23 indicates homology		 VESLICAPAVDLDALR
862 452.7635 903.5124 903.5025 11.0 0 12 0.64 +1Score > 39 indicates identity
Score > 22 indicates homology		 LSVQITSR + Deamidated (NQ)
1326 560.3350 1118.6554 1118.6369 16.6 0 12 0.69 +1Score > 36 indicates identity
Score > 22 indicates homology		 SLMSLVNVLK + Oxidation (M)
3346 1077.1189 2152.2232 2152.2038 9.03 1 12 0.16 +1Score > 31 indicates identity
Score > 16 indicates homology		 LPGDISGVKPLGLMDITVRR + Oxidation (M)
2492 553.9676 1658.8810 1658.8563 14.9 1 12 0.42 +1Score > 40 indicates identity
Score > 20 indicates homology		 SSLVGWPQVIDRMR + Oxidation (M)
3393 1089.5220 2177.0294 2177.0211 3.81 1 12 0.3 +1Score > 39 indicates identity
Score > 19 indicates homology		 DQITVWGFHSDNKIQMNK + Deamidated (NQ); Oxidation (M)
1862 456.2160 1365.6262 1365.6347 -6.24 1 12 0.74 +1Score > 40 indicates identity
Score > 23 indicates homology		 LLGMDPEHGRPE + Oxidation (M)
2588 569.3248 1704.9526 1704.9273 14.8 1 12 0.27 +1Score > 35 indicates identity
Score > 18 indicates homology		 GVFIFLMPPSLAELR + Oxidation (M)
2707 879.4704 1756.9262 1756.9393 -7.42 0 12 0.35 +1Score > 39 indicates identity
Score > 20 indicates homology		 QLAQAMQALLPSLTVR + 2 Deamidated (NQ); Oxidation (M)
454 364.7205 727.4264 727.4229 4.94 0 12 0.35 +1Score > 37 indicates identity
Score > 19 indicates homology		 VGPGVTAK
1278 364.1923 1089.5551 1089.5554 -0.26 0 12 0.67 +1Score > 42 indicates identity
Score > 22 indicates homology		 TIQAQLDSLT + Deamidated (NQ)
2617 859.4614 1716.9082 1716.9331 -14.5 1 12 0.28 +1Score > 39 indicates identity
Score > 18 indicates homology		 TLTMIALILTQKNQE + Deamidated (NQ)
3699 1181.1263 2360.2380 2360.2080 12.7 0 12 0.3 +1Score > 37 indicates identity
Score > 19 indicates homology		 DVLVVNNNAAAVMLVLGTMAQGK + Deamidated (NQ); 2 Oxidation (M)
2186 759.9357 1517.8568 1517.8705 -8.97 1 11 0.81 +1Score > 36 indicates identity
Score > 23 indicates homology		 ISLVNIKYLVLDE
3472 741.4034 2221.1884 2221.1531 15.9 1 11 0.67 +1Score > 36 indicates identity
Score > 22 indicates homology		 YNIYVQAINFPTVPIGQER
1753 655.3309 1308.6472 1308.6422 3.86 1 11 0.71 +1Score > 41 indicates identity
Score > 22 indicates homology		 KSANNAHQVPDK + Deamidated (NQ)
3651 776.0903 2325.2491 2325.2402 3.81 1 11 0.48 +1Score > 35 indicates identity
Score > 21 indicates homology		 TLNLLLLHLEQTMTAYVSHK + Deamidated (NQ)
1669 423.2251 1266.6535 1266.6543 -0.65 1 11 0.56 +1Score > 40 indicates identity
Score > 21 indicates homology		 FNPIRLGFMR + Deamidated (NQ); Oxidation (M)
3786 813.4608 2437.3606 2437.3441 6.76 1 11 0.17 +1Score > 31 indicates identity
Score > 16 indicates homology		 LIEGYLNNRPNLAGIVQIVDAR
3723 794.0999 2379.2779 2379.2885 -4.49 0 11 0.31 +1Score > 35 indicates identity
Score > 19 indicates homology		 FGIGADGVLFLAKPLHTSLHMR
3894 509.6474 2543.2006 2543.1663 13.5 1 11 0.68 +1Score > 38 indicates identity
Score > 22 indicates homology		 VDDAVLQHIYRQPDQSTAVAANE + 4 Deamidated (NQ)
617 399.1969 796.3792 796.3715 9.72 1 11 0.74 +1Score > 39 indicates identity
Score > 23 indicates homology		 SPRNPPE + Deamidated (NQ)
2067 733.3383 1464.6620 1464.6667 -3.18 1 11 0.32 +1Score > 39 indicates identity
Score > 19 indicates homology		 NDTAAGRLWDMSK + Deamidated (NQ)
2461 546.3295 1635.9667 1635.9712 -2.76 1 11 0.27 +1Score > 30 indicates identity
Score > 18 indicates homology		 GLVLSLPELLGWAIR
2587 569.3119 1704.9139 1704.8934 12.0 0 11 0.91 +1Score > 38 indicates identity
Score > 24 indicates homology		 DQSYVLAVLQQAQLK + 2 Deamidated (NQ)
2665 580.6417 1738.9033 1738.9240 -11.9 1 11 0.94 +1Score > 39 indicates identity
Score > 24 indicates homology		 TEQIIVVPQLQLLDE + 2 Deamidated (NQ)
3287 1064.5525 2127.0904 2127.1180 -13.0 0 11 0.16 +1Score > 39 indicates identity
Score > 16 indicates homology		 AAGVINNVVASVPMVVNAVMR + Deamidated (NQ); Oxidation (M)
1405 576.2983 1150.5820 1150.5982 -14.1 1 11 0.98 +1Score > 41 indicates identity
Score > 24 indicates homology		 QPGPAPQTVEK
2681 581.6502 1741.9288 1741.9502 -12.3 1 11 0.93 +1Score > 39 indicates identity
Score > 24 indicates homology		 VPQSVLPDTVFEAIVK + Deamidated (NQ)
2766 898.9711 1795.9276 1795.9540 -14.7 1 11 0.6 +1Score > 39 indicates identity
Score > 22 indicates homology		 EAASSAPALRPLGAAATSR
4785 821.9970 4104.9486 4104.9223 6.40 1 11 0.36 +1Score > 33 indicates identity
Score > 19 indicates homology		 MINKNISIQINGEPFNCSEPLSLQFLLNYLDFNSE + 4 Deamidated (NQ)
1632 417.2213 1248.6421 1248.6503 -6.58 0 11 0.85 +1Score > 41 indicates identity
Score > 23 indicates homology		 NWYVVGDLGVK
2763 597.3163 1788.9271 1788.9621 -19.6 0 11 0.61 +1Score > 40 indicates identity
Score > 22 indicates homology		 TVGIIGVGNIGNLLYQR + 3 Deamidated (NQ)
786 437.7165 873.4184 873.4344 -18.3 1 11 0.47 +1Score > 42 indicates identity
Score > 21 indicates homology		 LKHNFSE
3079 667.3307 1998.9703 1998.9721 -0.90 1 11 0.58 +1Score > 40 indicates identity
Score > 21 indicates homology		 LGTNIRIFVDSPGTMYAE + Oxidation (M)
2454 545.3143 1632.9211 1632.8909 18.5 1 11 0.71 +1Score > 34 indicates identity
Score > 22 indicates homology		 KIFVTLMGDLVEPR + Oxidation (M)
2182 506.9508 1517.8306 1517.8566 -17.1 1 11 0.56 +1Score > 38 indicates identity
Score > 21 indicates homology		 RVDLPEPVDIPIR
3140 1020.0162 2038.0178 2037.9816 17.8 1 11 0.37 +1Score > 40 indicates identity
Score > 20 indicates homology		 EPVVITNEYTVSQVAQMK + 3 Deamidated (NQ)
1791 663.3651 1324.7156 1324.7350 -14.6 1 11 0.59 +1Score > 38 indicates identity
Score > 22 indicates homology		 AQPLDILNKANK + Deamidated (NQ)
855 451.2541 900.4936 900.4889 5.23 1 11 0.59 +1Score > 42 indicates identity
Score > 22 indicates homology		 NRTAANVR
2146 752.3918 1502.7690 1502.7828 -9.13 1 11 0.77 +1Score > 41 indicates identity
Score > 23 indicates homology		 ANLTNTSIVKALQE + 2 Deamidated (NQ)
369 343.7144 685.4142 685.4123 2.88 0 11 0.74 +1Score > 42 indicates identity
Score > 22 indicates homology		 NGIGVVK
2356 794.9249 1587.8352 1587.8369 -1.04 0 11 0.27 +1Score > 40 indicates identity
Score > 18 indicates homology		 AIAVNDFQNGITGIR
2258 776.4066 1550.7986 1550.7828 10.2 0 11 0.88 +1Score > 40 indicates identity
Score > 23 indicates homology		 NFTIDLVNLSVSTE
2895 938.9542 1875.8938 1875.9144 -11.0 1 11 0.94 +1Score > 40 indicates identity
Score > 24 indicates homology		 VKAMINAMQPGDVIMLE + Deamidated (NQ); Oxidation (M)
2255 775.9058 1549.7970 1549.7810 10.3 0 11 0.94 +1Score > 40 indicates identity
Score > 23 indicates homology		 MLPSQSPAIFTVSR + Deamidated (NQ); Oxidation (M)
2613 857.4447 1712.8748 1712.9057 -18.0 1 11 0.69 +1Score > 40 indicates identity
Score > 22 indicates homology		 VTNVTRVDGVQPTAVR + 2 Deamidated (NQ)
2110 495.9185 1484.7337 1484.7479 -9.61 0 11 0.32 +1Score > 40 indicates identity
Score > 19 indicates homology		 NSMNVPIVHLSMK + Oxidation (M)
3082 1001.5372 2001.0598 2001.0670 -3.57 1 11 0.51 +1Score > 39 indicates identity
Score > 21 indicates homology		 VNTLPLYVQLDLQKLDE + Deamidated (NQ)
2281 782.3895 1562.7644 1562.7438 13.2 1 11 0.84 +1Score > 41 indicates identity
Score > 23 indicates homology		 LTGVRDVTDHQHGE
2794 904.9908 1807.9670 1807.9581 4.97 1 11 0.47 +1Score > 38 indicates identity
Score > 20 indicates homology		 SLNSPIGKFNHEPIVR + Deamidated (NQ)
2185 759.9299 1517.8452 1517.8202 16.5 1 11 0.97 +1Score > 37 indicates identity
Score > 24 indicates homology		 VKFNVINTAVQGAR + 2 Deamidated (NQ)
2239 772.4312 1542.8478 1542.8439 2.55 0 11 0.54 +1Score > 38 indicates identity
Score > 21 indicates homology		 NMVVSNILLNNIAK + Deamidated (NQ)
2663 868.9423 1735.8700 1735.8377 18.7 0 11 0.93 +1Score > 41 indicates identity
Score > 23 indicates homology		 IQSQTFLNIADNSGAR + 2 Deamidated (NQ)
2678 581.6485 1741.9237 1741.9210 1.51 1 11 0.46 +1Score > 39 indicates identity
Score > 20 indicates homology		 APLAVVGDTDKTGTQIR + Deamidated (NQ)
4302 727.6257 2906.4737 2906.4749 -0.40 1 11 0.34 +1Score > 36 indicates identity
Score > 19 indicates homology		 FPASPGPQQALMPPNLWSLRAKPGTAR + 3 Deamidated (NQ); Oxidation (M)
943 468.7661 935.5176 935.5076 10.7 1 11 0.63 +1Score > 38 indicates identity
Score > 22 indicates homology		 IFDTKNAK
1114 337.5271 1009.5595 1009.5570 2.47 0 11 0.54 +1Score > 37 indicates identity
Score > 21 indicates homology		 GAIRPGHFR
1466 586.8518 1171.6890 1171.6965 -6.34 0 11 0.25 +1Score > 36 indicates identity
Score > 18 indicates homology		 VLDAIYLLPR
3495 1119.5807 2237.1468 2237.1587 -5.28 1 11 0.12 +1Score > 38 indicates identity
Score > 14 indicates homology		 VTIRGSNLGQHVQDVLDMVR + Deamidated (NQ)
789 438.2284 874.4422 874.4548 -14.4 1 11 0.99 +1Score > 44 indicates identity
Score > 24 indicates homology		 QATELWK
1952 703.8958 1405.7770 1405.7790 -1.36 1 11 0.97 +1Score > 37 indicates identity
Score > 24 indicates homology		 APARGAAPVNNLQK
2567 846.9151 1691.8156 1691.8478 -19.0 1 11 0.92 +1Score > 41 indicates identity
Score > 23 indicates homology		 LTYIRAQGAGGQNVNK + 3 Deamidated (NQ)
3498 560.5368 2238.1181 2238.1453 -12.2 0 11 0.56 +1Score > 39 indicates identity
Score > 21 indicates homology		 NGIHILDLTQTVPMLDQALK + 3 Deamidated (NQ); Oxidation (M)
1678 425.5521 1273.6345 1273.6514 -13.3 1 11 0.68 +1Score > 41 indicates identity
Score > 22 indicates homology		 TSKDLDIPTQR + Deamidated (NQ)
4040 896.1039 2685.2899 2685.2592 11.4 1 11 0.2 +1Score > 38 indicates identity
Score > 17 indicates homology		 LVDVHWNSSQQIMGLDSKTVGPQE + 2 Deamidated (NQ); Oxidation (M)
3330 537.2972 2145.1597 2145.1722 -5.81 1 11 0.22 +1Score > 36 indicates identity
Score > 17 indicates homology		 VVLAYSGGLDTSVIVPWLKE
3554 756.3895 2266.1467 2266.1668 -8.87 0 11 0.28 +1Score > 39 indicates identity
Score > 18 indicates homology		 LFQIGVAPSSLTLVAVTHMHE + Deamidated (NQ); Oxidation (M)
2505 833.4855 1664.9564 1664.9423 8.52 0 11 0.95 +1Score > 33 indicates identity
Score > 23 indicates homology		 LIGPDIIMEPLVLDK
3059 663.6533 1987.9381 1987.9304 3.85 1 11 0.38 +1Score > 39 indicates identity
Score > 19 indicates homology		 QCKMIFNQTSIMNLLK + 4 Deamidated (NQ); Oxidation (M)
3132 1018.5411 2035.0676 2035.0700 -1.14 1 11 0.73 +1Score > 38 indicates identity
Score > 22 indicates homology		 AIFNQDILPFKDLIAMGK + 2 Deamidated (NQ)
3354 720.0532 2157.1378 2157.0962 19.3 0 11 0.59 +1Score > 38 indicates identity
Score > 21 indicates homology		 MQAVEPDLAFVLPAANAMLR + Deamidated (NQ)
1080 332.8551 995.5435 995.5287 14.8 1 11 0.6 +1Score > 37 indicates identity
Score > 21 indicates homology		 VSVSSNKFK + Deamidated (NQ)
1750 654.3429 1306.6712 1306.6703 0.71 0 11 0.78 +1Score > 41 indicates identity
Score > 23 indicates homology		 IQFMNALIANR + Deamidated (NQ); Oxidation (M)
2664 579.6317 1735.8733 1735.8894 -9.28 0 11 0.55 +1Score > 41 indicates identity
Score > 21 indicates homology		 TGVSGVFPGNYVTPVSR
3286 710.0351 2127.0835 2127.1259 -19.9 1 11 0.27 +1Score > 39 indicates identity
Score > 18 indicates homology		 RSMILPDFVGLTISVHNGR + Oxidation (M)
1264 543.7742 1085.5338 1085.5512 -16.0 1 11 0.58 +1Score > 40 indicates identity
Score > 21 indicates homology		 CRPNVAGRR + Deamidated (NQ)
2952 640.3465 1918.0177 1917.9870 16.0 1 11 0.23 +1Score > 38 indicates identity
Score > 17 indicates homology		 DGTVIIPEVLRPYMGNK + Deamidated (NQ); Oxidation (M)
878 912.4891 911.4818 911.4752 7.21 1 11 0.49 +1Score > 39 indicates identity
Score > 20 indicates homology		 KFLNDFK + Deamidated (NQ)
478 368.7280 735.4414 735.4391 3.13 0 11 0.56 +1Score > 34 indicates identity
Score > 21 indicates homology		 LPHTIR
860 452.2313 902.4480 902.4457 2.56 0 11 0.87 +1Score > 43 indicates identity
Score > 23 indicates homology		 AAQAGDLTR + Deamidated (NQ)
2883 934.0217 1866.0288 1866.0251 2.02 1 11 0.42 +1Score > 35 indicates identity
Score > 20 indicates homology		 QLEQTLAPLFPGVPISR + Deamidated (NQ)
2951 959.5135 1917.0124 1917.0207 -4.30 1 11 0.98 +1Score > 38 indicates identity
Score > 23 indicates homology		 RLQQIQFSTSLIPLNR + 4 Deamidated (NQ)
3157 682.6940 2045.0602 2045.0220 18.7 1 11 0.98 +1Score > 38 indicates identity
Score > 24 indicates homology		 SSMILMRHLLMDAQVQR + Deamidated (NQ); Oxidation (M)
3239 526.5462 2102.1557 2102.1194 17.3 0 11 0.3 +1Score > 34 indicates identity
Score > 18 indicates homology		 MVQPDPPANLVVSAIPGKPR + Deamidated (NQ); Oxidation (M)
3958 866.7797 2597.3173 2597.2716 17.6 1 11 0.34 +1Score > 37 indicates identity
Score > 19 indicates homology		 SGFDITAASELMAILALSANLADMR + Deamidated (NQ); Oxidation (M)
1670 635.3572 1268.6998 1268.6798 15.8 0 11 0.97 +1Score > 39 indicates identity
Score > 23 indicates homology		 AQPVLLEPVMR + Deamidated (NQ); Oxidation (M)
2008 718.3838 1434.7530 1434.7758 -15.9 1 11 0.84 +1Score > 40 indicates identity
Score > 23 indicates homology		 QIFFVPKNSLIE + Deamidated (NQ)
2774 451.2077 1800.8017 1800.8101 -4.66 1 11 0.97 +1Score > 38 indicates identity
Score > 23 indicates homology		 TQMINFFNVGDADRR + 2 Deamidated (NQ); Oxidation (M)
Page: Previous 1 …8 9 10 11 12 13 14 15 16 17 18 … 40 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/