MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita3 sp
MS data file : PRT1270_T-BRSC_3_20250714120051.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:41:29 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 5,012

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 901–1000 (out of 3956)

Page: Previous 1 …5 6 7 8 9 10 11 12 13 14 15 … 40 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
1452 585.3236 1168.6326 1168.6452 -10.7 0 14 0.34 +1Score > 39 indicates identity
Score > 22 indicates homology		 IGANSVIGPDVK
2741 886.9525 1771.8904 1771.8815 5.08 1 14 0.83 +1Score > 40 indicates identity
Score > 26 indicates homology		 VNFSVNFKCLSSQIK + 2 Deamidated (NQ)
3026 657.6706 1969.9900 1969.9927 -1.36 1 14 0.68 +1Score > 40 indicates identity
Score > 25 indicates homology		 ISMMFAIMGVAATKLLPE + 3 Oxidation (M)
827 447.7255 893.4364 893.4203 18.1 1 14 0.44 +1Score > 42 indicates identity
Score > 23 indicates homology		 KSGSSSGQR + Deamidated (NQ)
2563 845.9312 1689.8478 1689.8348 7.70 1 14 0.55 +1Score > 41 indicates identity
Score > 24 indicates homology		 NIDVNQPLYLQKLE + 4 Deamidated (NQ)
3068 665.0082 1992.0028 1992.0172 -7.26 1 14 0.52 +1Score > 40 indicates identity
Score > 24 indicates homology		 WPIAATILSMTKLNMDR + 2 Oxidation (M)
1732 649.8745 1297.7344 1297.7242 7.93 0 14 0.63 +1Score > 38 indicates identity
Score > 25 indicates homology		 TITPLINPSSVR + Deamidated (NQ)
2123 498.9544 1493.8414 1493.8453 -2.65 0 14 0.76 +1Score > 35 indicates identity
Score > 26 indicates homology		 GDLLVLNGDVPLLR + Deamidated (NQ)
2398 806.9338 1611.8530 1611.8832 -18.7 0 14 0.71 +1Score > 39 indicates identity
Score > 25 indicates homology		 GLSVGDTIQAGVSAPIK
279 318.2107 634.4068 634.4054 2.31 0 14 0.12 +1Score > 26 indicates identity
Score > 18 indicates homology		 IYIVK
579 392.7516 783.4886 783.4854 4.09 0 14 0.46 +1Score > 35 indicates identity
Score > 23 indicates homology		 VIVTPGAK
1207 350.8623 1049.5651 1049.5506 13.8 1 14 0.53 +1Score > 39 indicates identity
Score > 24 indicates homology		 KYGNGVLGDK
2436 814.9191 1627.8236 1627.8028 12.8 1 14 0.52 +1Score > 40 indicates identity
Score > 24 indicates homology		 DLIHCLFSPGENVK
4353 744.3787 2973.4857 2973.4827 1.00 1 14 0.099 +1Score > 36 indicates identity
Score > 17 indicates homology		 GTLLGEITFSMPGAHNVLNALATIAVAME + Deamidated (NQ); 2 Oxidation (M)
1585 410.5764 1228.7074 1228.7027 3.83 1 14 0.73 +1Score > 38 indicates identity
Score > 25 indicates homology		 QLSEGLLALSAK
1449 390.2170 1167.6292 1167.6360 -5.85 0 14 0.54 +1Score > 39 indicates identity
Score > 24 indicates homology		 NRPVPSITAGR + Deamidated (NQ)
2236 772.4182 1542.8218 1542.8114 6.78 1 14 0.92 +1Score > 40 indicates identity
Score > 26 indicates homology		 ITINSKPGASGGQRR + 2 Deamidated (NQ)
2791 904.4633 1806.9120 1806.9220 -5.48 0 14 0.74 +1Score > 40 indicates identity
Score > 25 indicates homology		 INIVVLGSMNTDLVMR + Deamidated (NQ); 2 Oxidation (M)
235 306.7082 611.4018 611.4119 -16.4 0 14 0.24 +1Score > 32 indicates identity
Score > 21 indicates homology		 VIKPR
1730 649.3769 1296.7392 1296.7150 18.7 1 14 0.46 +1Score > 37 indicates identity
Score > 23 indicates homology		 NNLVIDTPRVR + Deamidated (NQ)
2904 941.5038 1880.9930 1880.9679 13.3 1 14 0.36 +1Score > 38 indicates identity
Score > 22 indicates homology		 LKNNVFSHVDMHVGLR + Oxidation (M)
2208 510.6240 1528.8502 1528.8402 6.53 0 14 0.28 +1Score > 37 indicates identity
Score > 21 indicates homology		 AFNIDLGFPLIGPR
2624 860.9464 1719.8782 1719.9090 -17.9 1 14 0.92 +1Score > 40 indicates identity
Score > 26 indicates homology		 QLNQHNAMVKAIPVR + 2 Deamidated (NQ)
3437 733.0565 2196.1477 2196.1902 -19.4 1 14 0.49 +1Score > 38 indicates identity
Score > 24 indicates homology		 KQQLNQLAAYQPGLSPQALK + Deamidated (NQ)
1567 407.8766 1220.6080 1220.5893 15.3 1 14 0.48 +1Score > 42 indicates identity
Score > 24 indicates homology		 KLNDMNNLMK + Deamidated (NQ)
1574 613.7944 1225.5742 1225.5537 16.8 1 14 0.29 +1Score > 40 indicates identity
Score > 21 indicates homology		 TTFDIEMLQE
263 315.2033 628.3920 628.3908 1.97 0 14 0.86 +1Score > 42 indicates identity
Score > 26 indicates homology		 LGNVVK
385 692.3640 691.3567 691.3653 -12.4 1 14 0.5 +1Score > 42 indicates identity
Score > 24 indicates homology		 ALRFGE
2199 509.5826 1525.7260 1525.7558 -19.6 1 14 0.72 +1Score > 40 indicates identity
Score > 25 indicates homology		 HLCTIIQQNELR + 2 Deamidated (NQ)
476 368.2252 734.4358 734.4327 4.32 0 14 0.59 +1Score > 36 indicates identity
Score > 24 indicates homology		 LVFQTK
2652 866.8916 1731.7686 1731.7807 -6.99 0 14 0.3 +1Score > 39 indicates identity
Score > 21 indicates homology		 NDNPLVDMQAMSPTAK + Deamidated (NQ)
2125 499.2219 1494.6439 1494.6297 9.51 1 14 0.15 +1Score > 38 indicates identity
Score > 18 indicates homology		 AEPTEQSFMQPGR + 2 Deamidated (NQ); Oxidation (M)
2119 747.3876 1492.7606 1492.7517 6.02 0 14 0.81 +1Score > 41 indicates identity
Score > 26 indicates homology		 LGMMLSLQNVIQK + 3 Deamidated (NQ); Oxidation (M)
1518 401.5519 1201.6339 1201.6303 2.99 1 14 0.98 +1Score > 41 indicates identity
Score > 27 indicates homology		 VDVSTLEAGGVR
2476 549.6119 1645.8139 1645.7882 15.6 1 14 0.78 +1Score > 41 indicates identity
Score > 26 indicates homology		 FNAQIPMNLRNGPR + 3 Deamidated (NQ); Oxidation (M)
3721 794.0995 2379.2767 2379.2885 -4.99 0 14 0.16 +1Score > 35 indicates identity
Score > 19 indicates homology		 FGIGADGVLFLAKPLHTSLHMR
422 354.6893 707.3640 707.3636 0.63 0 14 0.65 +1Score > 41 indicates identity
Score > 25 indicates homology		 MTTLAR + Oxidation (M)
2157 755.9204 1509.8262 1509.8555 -19.4 1 14 0.54 +1Score > 37 indicates identity
Score > 24 indicates homology		 TLYYRVLIDNIK
2906 471.7309 1882.8945 1882.8818 6.74 0 14 0.4 +1Score > 40 indicates identity
Score > 23 indicates homology		 LCSLNINMHHDPFLR + Deamidated (NQ); Oxidation (M)
689 418.7125 835.4104 835.4109 -0.60 0 14 0.39 +1Score > 42 indicates identity
Score > 23 indicates homology		 MTDATVAK
1257 541.7526 1081.4906 1081.4783 11.4 1 14 0.96 +1Score > 40 indicates identity
Score > 26 indicates homology		 EITSNMMQK + Deamidated (NQ)
2337 791.3856 1580.7566 1580.7426 8.90 1 14 0.8 +1Score > 41 indicates identity
Score > 26 indicates homology		 SGVLKSNCIMDVLE + Deamidated (NQ); Oxidation (M)
908 308.5164 922.5274 922.5348 -8.07 1 14 0.86 +1Score > 37 indicates identity
Score > 26 indicates homology		 HRLQLQK + Deamidated (NQ)
2501 555.9800 1664.9182 1664.9025 9.42 1 14 0.32 +1Score > 36 indicates identity
Score > 22 indicates homology		 FGYINLQDILKIVE + Deamidated (NQ)
2655 578.3580 1732.0522 1732.0359 9.40 1 14 0.75 +1Score > 25 indicates identity VIKTQNLAALLHAIAR + Deamidated (NQ)
662 410.2784 818.5422 818.5378 5.44 0 14 0.31 +1Score > 23 indicates identity
Score > 21 indicates homology		 LLVHPLK
1524 602.8375 1203.6604 1203.6499 8.76 1 14 0.55 +1Score > 39 indicates identity
Score > 24 indicates homology		 NIKQLAQIFE + Deamidated (NQ)
4636 878.4505 3509.7729 3509.7354 10.7 1 14 0.12 +1Score > 34 indicates identity
Score > 17 indicates homology		 ANPGLYNRVLVDYYGSPTPLQQLASFAIPDAR + 4 Deamidated (NQ)
2531 836.0023 1669.9900 1669.9614 17.1 1 14 0.081 +1Score > 30 indicates identity
Score > 16 indicates homology		 IADSLVLKTDVQIQK
1966 708.3408 1414.6670 1414.6656 1.00 1 14 0.84 +1Score > 40 indicates identity
Score > 26 indicates homology		 DAGLPVYLYEFE
1560 609.8656 1217.7166 1217.7019 12.1 1 14 0.88 +1Score > 34 indicates identity
Score > 26 indicates homology		 FANTLLELGIK
2102 740.3535 1478.6924 1478.7113 -12.8 1 14 0.51 +1Score > 41 indicates identity
Score > 24 indicates homology		 NVNITHPADNEVR + Deamidated (NQ)
2785 902.4133 1802.8120 1802.8322 -11.2 1 14 0.5 +1Score > 39 indicates identity
Score > 23 indicates homology		 SSATVYFQADKTNNVR + 3 Deamidated (NQ)
1922 464.2628 1389.7666 1389.7504 11.7 0 14 0.36 +1Score > 38 indicates identity
Score > 22 indicates homology		 FILSDALDIDLR
2607 570.9703 1709.8891 1709.8584 17.9 0 14 0.43 +1Score > 39 indicates identity
Score > 23 indicates homology		 IVNNSDNPLQAGQIVE
596 394.7182 787.4218 787.4076 18.1 0 14 0.67 +1Score > 44 indicates identity
Score > 25 indicates homology		 LDLNDAK
1722 647.3627 1292.7108 1292.6976 10.3 1 14 0.63 +1Score > 38 indicates identity
Score > 24 indicates homology		 NISFNTINLKK + 2 Deamidated (NQ)
1838 451.2214 1350.6424 1350.6562 -10.2 1 14 0.23 +1Score > 41 indicates identity
Score > 20 indicates homology		 MTDTDRLLSAGR + Oxidation (M)
772 434.2891 866.5636 866.5589 5.45 0 14 0.71 +1Score > 29 indicates identity
Score > 25 indicates homology		 IGGLPAVLK
1374 570.2639 1138.5132 1138.5117 1.33 1 14 0.2 +1Score > 40 indicates identity
Score > 19 indicates homology		 FSAMGVWNEV
2803 604.3590 1810.0552 1810.0352 11.0 1 14 0.59 +1Score > 30 indicates identity
Score > 24 indicates homology		 EPIFVIAELNLIGLNR
2466 547.6298 1639.8676 1639.8722 -2.84 0 14 0.51 +1Score > 39 indicates identity
Score > 23 indicates homology		 GWFYTLNVISTALR
3577 761.0637 2280.1693 2280.1651 1.82 1 14 0.18 +1Score > 38 indicates identity
Score > 19 indicates homology		 WLINHLTDFDGKQLHSVTR + Deamidated (NQ)
1220 353.5281 1057.5625 1057.5768 -13.5 1 14 0.83 +1Score > 41 indicates identity
Score > 26 indicates homology		 KAQQVLGVSE
3950 862.4531 2584.3375 2584.3393 -0.71 1 14 0.23 +1Score > 37 indicates identity
Score > 20 indicates homology		 VDPVNFKLLSQCIQVVLAAHMGK + 2 Deamidated (NQ); Oxidation (M)
981 475.7338 949.4530 949.4465 6.91 1 14 0.79 +1Score > 42 indicates identity
Score > 25 indicates homology		 QSDGTGKTR + Deamidated (NQ)
3435 732.7206 2195.1400 2195.1143 11.7 1 14 0.14 +1Score > 38 indicates identity
Score > 18 indicates homology		 LSISGNYNLETLMSPLGITR + Deamidated (NQ); Oxidation (M)
1874 457.2238 1368.6496 1368.6265 16.9 1 14 0.59 +1Score > 40 indicates identity
Score > 24 indicates homology		 TNSGVMTAEIAMK + Deamidated (NQ); Oxidation (M)
2438 814.9667 1627.9188 1627.9198 -0.59 1 14 0.81 +1Score > 35 indicates identity
Score > 25 indicates homology		 LRQASLSVLWWLR + Deamidated (NQ)
3795 612.5459 2446.1545 2446.1685 -5.74 1 14 0.3 +1Score > 38 indicates identity
Score > 21 indicates homology		 SSELYIQGTHNIANALACLALGE + 2 Deamidated (NQ)
2626 860.9514 1719.8882 1719.8978 -5.53 1 14 0.65 +1Score > 40 indicates identity
Score > 24 indicates homology		 QLFNIKVLNVNTCR + 2 Deamidated (NQ)
3187 688.0398 2061.0976 2061.1101 -6.10 1 14 0.25 +1Score > 37 indicates identity
Score > 20 indicates homology		 MVLTNLQKITGLLCVLVE + 2 Deamidated (NQ); Oxidation (M)
778 871.4459 870.4386 870.4559 -19.8 1 14 0.86 +1Score > 39 indicates identity
Score > 26 indicates homology		 QAPIASRE
3447 735.0620 2202.1642 2202.1644 -0.11 1 14 0.52 +1Score > 37 indicates identity
Score > 23 indicates homology		 VDFPSGTALAAANVILSANSRK + Deamidated (NQ)
3940 861.1327 2580.3763 2580.3622 5.47 1 14 0.071 +1Score > 35 indicates identity
Score > 15 indicates homology		 YIGLNPVIVHGGGPQIGQVLKSMGK + 3 Deamidated (NQ); Oxidation (M)
2399 538.2922 1611.8548 1611.8290 16.0 1 14 0.83 +1Score > 39 indicates identity
Score > 25 indicates homology		 QLMEANVAPLVPTGR + Deamidated (NQ); Oxidation (M)
3264 706.3649 2116.0729 2116.0840 -5.28 1 14 0.82 +1Score > 39 indicates identity
Score > 25 indicates homology		 QYLNDLGIPFEIDPNLVR + Deamidated (NQ)
1480 591.3649 1180.7152 1180.6928 19.0 1 14 0.2 +1Score > 32 indicates identity
Score > 19 indicates homology		 QLLVPADIRR + Deamidated (NQ)
2381 535.6454 1603.9144 1603.9297 -9.57 1 14 0.5 +1Score > 34 indicates identity
Score > 23 indicates homology		 QSKGTIISIQFLLR + Deamidated (NQ)
1191 1036.5319 1035.5246 1035.5237 0.93 0 14 0.75 +1Score > 41 indicates identity
Score > 25 indicates homology		 VNQAFDTLK + Deamidated (NQ)
2105 740.8961 1479.7776 1479.7504 18.4 1 14 0.41 +1Score > 39 indicates identity
Score > 22 indicates homology		 NGRQFLTQLMQK + Deamidated (NQ); Oxidation (M)
807 442.2679 882.5212 882.5287 -8.41 1 14 0.76 +1Score > 36 indicates identity
Score > 25 indicates homology		 IDPLAARK
2027 722.4115 1442.8084 1442.7841 16.9 1 14 0.96 +1Score > 37 indicates identity
Score > 26 indicates homology		 GNQAIQRSIDTIK
1426 579.3076 1156.6006 1156.6128 -10.5 0 14 0.85 +1Score > 40 indicates identity
Score > 25 indicates homology		 LYLYNTLTR + Deamidated (NQ)
1605 619.3146 1236.6146 1236.5986 13.0 1 14 0.66 +1Score > 41 indicates identity
Score > 24 indicates homology		 GGEQSQLNYLK + Deamidated (NQ)
2499 555.9787 1664.9143 1664.9025 7.07 1 14 0.34 +1Score > 37 indicates identity
Score > 21 indicates homology		 FGYINLQDILKIVE + Deamidated (NQ)
2521 556.9815 1667.9227 1667.9134 5.55 1 14 0.68 +1Score > 36 indicates identity
Score > 24 indicates homology		 NVFPKIDVAIGGPVLE + Deamidated (NQ)
3213 696.3427 2086.0063 2085.9816 11.8 1 14 0.39 +1Score > 39 indicates identity
Score > 22 indicates homology		 ALDTYNEINAVMNLVLFE + 2 Deamidated (NQ); Oxidation (M)
790 875.4818 874.4745 874.4582 18.6 1 14 0.67 +1Score > 42 indicates identity
Score > 24 indicates homology		 KVDMPASK
669 414.2598 826.5050 826.5137 -10.5 1 14 0.92 +1Score > 37 indicates identity
Score > 26 indicates homology		 VIRQGVR
2887 934.5063 1866.9980 1867.0302 -17.2 0 14 0.96 +1Score > 37 indicates identity
Score > 26 indicates homology		 VLAQSPLTSPIQSPISTK + Deamidated (NQ)
1310 369.8687 1106.5843 1106.5641 18.2 1 14 0.34 +1Score > 40 indicates identity
Score > 21 indicates homology		 KMNSAVILSE + Oxidation (M)
2072 734.4403 1466.8660 1466.8933 -18.6 1 14 0.73 +1Score > 32 indicates identity
Score > 25 indicates homology		 GIVRADLVLIGVSR
2790 904.4606 1806.9066 1806.8748 17.6 1 14 0.67 +1Score > 40 indicates identity
Score > 24 indicates homology		 GLQGEQGAPGLPGSQGPAGK + 2 Deamidated (NQ)
663 410.7266 819.4386 819.4524 -16.8 0 14 0.88 +1Score > 41 indicates identity
Score > 26 indicates homology		 VCTTIVK
2270 312.5894 1557.9106 1557.8991 7.41 1 14 0.19 +1Score > 32 indicates identity
Score > 19 indicates homology		 NVILLIPARYGSSR
340 336.1931 670.3716 670.3650 9.95 0 14 0.82 +1Score > 36 indicates identity
Score > 25 indicates homology		 AGDIAPK
2408 404.2335 1612.9049 1612.9162 -6.98 1 14 0.72 +1Score > 36 indicates identity
Score > 25 indicates homology		 TIVRSDPHIGLLHR
2638 862.4791 1722.9436 1722.9417 1.14 1 13 0.41 +1Score > 37 indicates identity
Score > 22 indicates homology		 NGQLISDWIPKSLPR
2490 414.9818 1655.8981 1655.9028 -2.85 1 13 0.54 +1Score > 38 indicates identity
Score > 23 indicates homology		 MKNNIINLAQDLIR + Deamidated (NQ)
Page: Previous 1 …5 6 7 8 9 10 11 12 13 14 15 … 40 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/