MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita3 sp
MS data file : PRT1270_T-BRSC_3_20250714120051.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:41:29 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 5,012

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 171–180 (out of 250)


Page: Previous 1 13 14 15 16 17 18 19 20 21 22 23  25 Next 

+171

Accession Score Description
1 ASTE_YERE8 41 Succinylglutamate desuccinylase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081) GN=astE PE=3 SV=1

+172

Accession Score Description
1 UP25_PSEMZ 41 Unknown protein 25 (Fragments) OS=Pseudotsuga menziesii PE=1 SV=1

+173

Accession Score Description
1 ARGJ_OCEIH 40 Arginine biosynthesis bifunctional protein argJ OS=Oceanobacillus iheyensis GN=argJ PE=3 SV=1

+174

Accession Score Description
1 THIG_AZOVD 39 Thiazole synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=thiG PE=3 SV=1

+175

Accession Score Description
1 ADD_PSEPK 39 Adenosine deaminase OS=Pseudomonas putida (strain KT2440) GN=add PE=3 SV=1

+176

Accession Score Description
1 FADB_SHESH 38 Fatty acid oxidation complex subunit alpha OS=Shewanella sediminis (strain HAW-EB3) GN=fadB PE=3 SV=1

+177

Accession Score Description
1 RS1_BUCAI 29 30S ribosomal protein S1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum GN=rpsA PE=3 SV=1

+178

Accession Score Description
1 ACSA1_PSEPK 38 Acetyl-coenzyme A synthetase 1 OS=Pseudomonas putida (strain KT2440) GN=acsA1 PE=3 SV=1

-179

Accession Score Description
1 MURA_PSEPG 38 UDP-N-acetylglucosamine 1-carboxyvinyltransferase OS=Pseudomonas putida (strain GB-1) GN=murA PE=3 SV=1
Score Mass Matches Sequences emPAI
179.1 MURA_PSEPG 38 45067 1 (1) 1 (1) 0.05
UDP-N-acetylglucosamine 1-carboxyvinyltransferase OS=Pseudomonas putida (strain GB-1) GN=murA PE=3 SV=1
5 samesets of MURA_PSEPG
MURA_PSEPK 38 45059 1 (1) 1 (1) 0.05
UDP-N-acetylglucosamine 1-carboxyvinyltransferase OS=Pseudomonas putida (strain KT2440) GN=murA PE=3 SV=1
MURA_PSEPU 38 44885 1 (1) 1 (1) 0.05
UDP-N-acetylglucosamine 1-carboxyvinyltransferase OS=Pseudomonas putida GN=murA PE=3 SV=1
MURA_PSEPW 38 44988 1 (1) 1 (1) 0.05
UDP-N-acetylglucosamine 1-carboxyvinyltransferase OS=Pseudomonas putida (strain W619) GN=murA PE=3 SV=1
MURA_PSEP1 38 45059 1 (1) 1 (1) 0.05
UDP-N-acetylglucosamine 1-carboxyvinyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=murA PE=3 SV=1
MURA_PSEE4 38 44999 1 (1) 1 (1) 0.05
UDP-N-acetylglucosamine 1-carboxyvinyltransferase OS=Pseudomonas entomophila (strain L48) GN=murA PE=3 SV=1

-1 peptide matches (1 non-duplicate, 0 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
4725   967.2903 3865.1321 3865.0812 13.2 1 38 0.0054 +1Score > 28 indicates identity U K.NAALPILAATLLADGPVTVGNLPHLHDITTMIELFGR.M + Deamidated (NQ)

+180

Accession Score Description
1 HPPD_PSEUJ 38 4-hydroxyphenylpyruvate dioxygenase OS=Pseudomonas sp. (strain P.J. 874) GN=hpd PE=1 SV=1
Page: Previous 1 13 14 15 16 17 18 19 20 21 22 23  25 Next 

Not what you expected? Try the select summary.