MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita3 sp
MS data file : PRT1270_T-BRSC_3_20250714120051.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:41:29 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 5,012

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 250)

Page: 1 2 3 4 5 6 … 25 Next 

+1

Accession Score Description
Family member distances as a dendrogram 1 EFTU2_PSEPK 1177 Elongation factor Tu-B OS=Pseudomonas putida (strain KT2440) GN=tufB PE=3 SV=1
5 EFTU_CARRP 73 Elongation factor Tu OS=Carsonella ruddii (strain PV) GN=tuf PE=3 SV=1
2 EFTU1_PSEPK 1045 Elongation factor Tu-A OS=Pseudomonas putida (strain KT2440) GN=tufA PE=3 SV=1
3 EFTU_BACAA 271 Elongation factor Tu OS=Bacillus anthracis (strain A0248) GN=tuf PE=3 SV=1
4 EFTU_ANATD 83 Elongation factor Tu OS=Anaerocellum thermophilum (strain DSM 6725 / Z-1320) GN=tuf PE=3 SV=1

-2

Accession Score Description
Family member distances as a dendrogram 1 ATPB_PSEPG 525 ATP synthase subunit beta OS=Pseudomonas putida (strain GB-1) GN=atpD PE=3 SV=1
5 ATPG_RHOP5 40 description
3 ATPB_LEGPA 167 ATP synthase subunit beta OS=Legionella pneumophila (strain Paris) GN=atpD PE=3 SV=1
2 CH60_PSEPK 473 60 kDa chaperonin OS=Pseudomonas putida (strain KT2440) GN=groL PE=3 SV=1
6 CH602_PROMS 39 60 kDa chaperonin 2 OS=Prochlorococcus marinus (strain AS9601) GN=groL2 PE=3 SV=1
4 CH602_SINMW 59 60 kDa chaperonin 2 OS=Sinorhizobium medicae (strain WSM419) GN=groL2 PE=3 SV=1
Cut threshold

Score Mass Matches Sequences emPAI
ATPB_PSEPG 525 49415 26 (19) 15 (12) 0.89
ATP synthase subunit beta OS=Pseudomonas putida (strain GB-1) GN=atpD PE=3 SV=1
2 samesets of ATPB_PSEPG
ATPB_PSEPK 525 49385 26 (19) 15 (12) 0.89
ATP synthase subunit beta OS=Pseudomonas putida (strain KT2440) GN=atpD PE=3 SV=1
ATPB_PSEP1 525 49385 26 (19) 15 (12) 0.89
ATP synthase subunit beta OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=atpD PE=3 SV=1
CH60_PSEPK 473 56765 40 (23) 21 (16) 1.12
60 kDa chaperonin OS=Pseudomonas putida (strain KT2440) GN=groL PE=3 SV=1
ATPB_LEGPA 167 50052 10 (6) 8 (4) 0.25
ATP synthase subunit beta OS=Legionella pneumophila (strain Paris) GN=atpD PE=3 SV=1
3 samesets of ATPB_LEGPA
ATPB_LEGPC 167 50052 10 (6) 8 (4) 0.25
ATP synthase subunit beta OS=Legionella pneumophila (strain Corby) GN=atpD PE=3 SV=1
ATPB_LEGPH 167 50052 10 (6) 8 (4) 0.25
ATP synthase subunit beta OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=atpD PE=3 SV=1
ATPB_LEGPL 167 50052 10 (6) 8 (4) 0.25
ATP synthase subunit beta OS=Legionella pneumophila (strain Lens) GN=atpD PE=3 SV=1
CH602_SINMW 59 57953 8 (3) 6 (3) 0.12
60 kDa chaperonin 2 OS=Sinorhizobium medicae (strain WSM419) GN=groL2 PE=3 SV=1
ATPG_RHOP5 40 0 2 (2) 2 (2) 0.15
description
CH602_PROMS 39 57816 8 (2) 5 (2) 0.08
60 kDa chaperonin 2 OS=Prochlorococcus marinus (strain AS9601) GN=groL2 PE=3 SV=1

-77 peptide matches (62 non-duplicate, 15 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U 1 2 3 4 5 6 Peptide
Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U 1 2 3 4 5 6 Peptide
143   487.3268 486.3195 486.3166 6.07 0 28 0.88 +1Score > 46 indicates identity
Score > 40 indicates homology		 X K.VAAVK.A
166   517.2988 516.2915 516.2907 1.52 0 42 0.042 +1Score > 46 indicates identity
Score > 41 indicates homology		 U X E.DIAAK.V
185   559.3840 558.3767 558.3741 4.73 0 23 0.24 +1Score > 34 indicates identity
Score > 30 indicates homology		 X R.VILSK.E
199   586.3583 585.3510 585.3486 4.14 0 41 0.034 +1Score > 39 indicates identity U X K.ATLGPK.G
220   301.6859 601.3572 601.3547 4.18 0 31 0.3 +1Score > 43 indicates identity
Score > 39 indicates homology		 X K.ISNIR.E
232   305.1848 608.3550 608.3533 2.79 0 13 0.35 +1Score > 31 indicates identity
Score > 21 indicates homology		 X X K.YVSLK.D
294   322.2118 642.4090 642.4064 4.05 0 11 1 +1Score > 41 indicates identity
Score > 23 indicates homology		 U X R.NVVLAK.S
296   643.4174 642.4101 642.4064 5.72 0 42 0.044 +2Score > 41 indicates identity U X R.NVVLAK.S
355   338.1887 674.3628 674.3599 4.36 0 28 0.63 +1Score > 43 indicates identity
Score > 38 indicates homology		 U X X K.DGVSVAK.E
356   675.3710 674.3637 674.3599 5.66 0 43 0.045 +1Score > 42 indicates identity U X X K.DGVSVAK.E
439   360.1782 718.3418 718.3398 2.79 0 27 0.82 +1Score > 43 indicates identity
Score > 38 indicates homology		 X X X K.APGFGDR.R
440   719.3497 718.3424 718.3398 3.59 0 27 0.35 +1Score > 43 indicates identity
Score > 35 indicates homology		 X X X K.APGFGDR.R
553   771.4388 770.4315 770.4286 3.75 1 34 0.16 +1Score > 39 indicates identity
Score > 39 indicates homology		 U X R.AVESPLR.Q
554   386.2231 770.4316 770.4286 3.91 1 41 0.038 +1Score > 39 indicates identity U X R.AVESPLR.Q
581   393.2498 784.4850 784.4807 5.57 1 12 1.2 +5Score > 40 indicates identity
Score > 26 indicates homology		 U X R.VGIEIVR.R
601   395.7017 789.3888 789.3868 2.54 0 26 0.32 +1Score > 43 indicates identity
Score > 33 indicates homology		 X X K.DSNVLDK.V
616   398.7267 795.4388 795.4351 4.71 1 10 0.39 +1Score > 38 indicates identity
Score > 19 indicates homology		 U X E.HLGNAKR.V + Deamidated (NQ)
671   827.5389 826.5316 826.5276 4.83 0 42 0.015 +2Score > 36 indicates identity U X X K.LAGGVAVIK.V
672 +1 414.2744 826.5342 826.5276 8.00 0 34 0.075 +1Score > 36 indicates identity U X X K.LAGGVAVIK.V
806   441.7953 881.5760 881.5698 7.08 0 34 0.026 +2Score > 30 indicates identity U X E.ILASLLPR.N
902   921.5072 920.4999 920.4967 3.46 0 54 0.0025 +1Score > 40 indicates identity U X K.SFGAPTITK.D
903 +2 461.2577 920.5008 920.4967 4.47 0 34 0.13 +1Score > 41 indicates identity
Score > 38 indicates homology		 U X K.SFGAPTITK.D
924 +1 464.3007 926.5868 926.5800 7.36 0 40 0.0087 +1Score > 34 indicates identity
Score > 32 indicates homology		 U X R.ALAAIIDLK.G
1011 +1 481.2809 960.5472 960.5393 8.28 0 62 0.0003 +1Score > 39 indicates identity U X X K.VGLFGGAGVGK.T
1015 +1 481.7764 961.5382 961.5345 3.88 0 31 0.098 +1Score > 39 indicates identity
Score > 33 indicates homology		 U X R.GVQYVLQR.Y
1016   962.5474 961.5401 961.5345 5.83 0 51 0.0036 +1Score > 39 indicates identity U X R.GVQYVLQR.Y
1029   972.5757 971.5684 971.5651 3.40 1 76 1.2e-005 +1Score > 40 indicates identity U X K.ATAAVVAELK.N
1032 +2 486.7931 971.5716 971.5651 6.71 1 54 0.00056 +1Score > 39 indicates identity
Score > 34 indicates homology		 U X K.ATAAVVAELK.N
1116 +1 337.8466 1010.5180 1010.5145 3.44 1 27 0.023 +1Score > 40 indicates identity
Score > 23 indicates homology		 U X R.VEDALHATR.A
1117   506.2664 1010.5182 1010.5145 3.71 1 57 9.2e-005 +1Score > 40 indicates identity
Score > 30 indicates homology		 U X R.VEDALHATR.A
1306   369.8681 1106.5825 1106.5642 16.5 0 1 3.7 +8Score > 41 indicates identity
Score > 19 indicates homology		 U X R.TIAMGTTDGLK.R
1334   561.3202 1120.6258 1120.6128 11.6 0 37 0.0062 +1Score > 38 indicates identity
Score > 27 indicates homology		 U X K.DTIAGFSGILK.G
1362   567.3220 1132.6294 1132.6162 11.7 1 45 0.0038 +1Score > 39 indicates identity
Score > 33 indicates homology		 U X X R.VALTGLTMAEK.F
1387   381.5537 1141.6393 1141.6455 -5.45 0 9 6.2 +10Score > 40 indicates identity
Score > 30 indicates homology		 X R.NVAAGANAITLK.K
1523   602.8351 1203.6556 1203.6499 4.75 0 29 0.049 +1Score > 40 indicates identity
Score > 28 indicates homology		 U X R.DVVPSVYNALK.V
1555   609.3071 1216.5996 1216.5944 4.32 0 37 0.007 +1Score > 42 indicates identity
Score > 28 indicates homology		 U X X K.AVAAGMNPMDLK.R
1660   421.8972 1262.6698 1262.6653 3.57 1 40 0.0017 +1Score > 40 indicates identity
Score > 25 indicates homology		 U X R.TIAMGTTDGLKR.G
1783   661.8282 1321.6418 1321.6336 6.22 1 38 0.0052 +1Score > 41 indicates identity
Score > 28 indicates homology		 U X K.DAFENMGAQLVK.E
1800 +1 664.8890 1327.7634 1327.7534 7.60 0 53 6.1e-005 +1Score > 37 indicates identity
Score > 23 indicates homology		 U X K.MLVGVNVLADAVK.A
1962   707.3135 1412.6124 1412.6056 4.88 1 51 0.0029 +1Score > 38 indicates identity U X K.AQIEDTTSDYDR.E
2039 -2 725.9096 1449.8046 1449.7827 15.1 1 90 4.3e-008 +1Score > 37 indicates identity
Score > 28 indicates homology		 U X R.YTLAGTEVSALLGR.M
2037   725.9073 1449.8000 1449.7827 11.9 1 (43) 0.00012 +1Score > 38 indicates identity
Score > 17 indicates homology		 U X R.YTLAGTEVSALLGR.M
2038   725.9093 1449.8040 1449.7827 14.7 1 (77) 4.2e-007 +1Score > 37 indicates identity
Score > 26 indicates homology		 U X R.YTLAGTEVSALLGR.M
2163   757.3871 1512.7596 1512.7532 4.25 1 76 8.8e-007 +1Score > 40 indicates identity
Score > 28 indicates homology		 U X K.GDNEDQNVGIALLR.R
2370   533.3011 1596.8815 1596.8723 5.73 0 38 0.046 +1Score > 37 indicates identity
Score > 37 indicates homology		 U X R.GLDVVDTGAAISVPVGK.A
2372 +1 799.4516 1596.8886 1596.8723 10.2 0 74 1.1e-005 +1Score > 37 indicates identity U X R.GLDVVDTGAAISVPVGK.A
2409   807.9043 1613.7940 1613.7897 2.71 0 66 1.4e-006 +1Score > 41 indicates identity
Score > 20 indicates homology		 U X R.QITANAGDEPSVVADK.V
2416   808.4019 1614.7892 1614.7737 9.64 0 88 3.5e-008 +1Score > 40 indicates identity
Score > 26 indicates homology		 U X R.QITANAGDEPSVVADK.V + Deamidated (NQ)
2471   822.9141 1643.8136 1643.8090 2.85 0 84 2.5e-007 +1Score > 40 indicates identity
Score > 31 indicates homology		 U X K.VALVYGQMNEPPGNR.L
2524   557.3331 1668.9775 1668.9451 19.4 1 8 1 +2Score > 32 indicates identity
Score > 20 indicates homology		 U X R.IVQIIGAVIDVEFPR.D + Deamidated (NQ)
2525 +1 835.4962 1668.9778 1668.9451 19.7 1 34 0.03 +1Score > 32 indicates identity U X R.IVQIIGAVIDVEFPR.D + Deamidated (NQ)
2844   614.9951 1841.9635 1841.9371 14.3 1 54 0.00019 +1Score > 39 indicates identity
Score > 29 indicates homology		 U X R.QITANAGDEPSVVADKVK.Q + Deamidated (NQ)
2865   928.9550 1855.8954 1855.8952 0.14 1 15 17 +6Score > 40 indicates identity U X R.QLDPLIVGQEHYDTAR.R + 2 Deamidated (NQ)
3012   980.0145 1958.0144 1957.9826 16.3 1 72 1.2e-005 +1Score > 39 indicates identity
Score > 35 indicates homology		 U X X R.FLSQPFFVAEVFTGSPGK.Y + Deamidated (NQ)
3013   653.6795 1958.0167 1957.9826 17.4 1 57 0.00017 +1Score > 39 indicates identity
Score > 32 indicates homology		 U X X R.FLSQPFFVAEVFTGSPGK.Y + Deamidated (NQ)
3063   995.5132 1989.0118 1989.0055 3.20 0 19 0.092 +2Score > 39 indicates identity
Score > 21 indicates homology		 U X R.DIASLGIYPAVDPLDSTSR.Q
3128   679.0300 2034.0682 2034.0415 13.1 1 2 2.8 +9Score > 38 indicates identity
Score > 18 indicates homology		 X K.VTRSGLQNAASIAGMVLTTE.C + Oxidation (M)
3747   801.4177 2401.2313 2401.1973 14.2 1 67 6e-005 +1Score > 38 indicates identity U X K.ANDAAGDGTTTATVLAQAIVNEGLK.A + Deamidated (NQ)
3748   801.4186 2401.2340 2401.1973 15.3 1 34 0.11 +1Score > 37 indicates identity U X K.ANDAAGDGTTTATVLAQAIVNEGLK.A + Deamidated (NQ)
3749   801.4194 2401.2364 2401.1973 16.3 1 68 4.7e-005 +1Score > 37 indicates identity U X K.ANDAAGDGTTTATVLAQAIVNEGLK.A + Deamidated (NQ)
3784 +1 813.0822 2436.2248 2436.1921 13.4 1 66 8.7e-005 +1Score > 38 indicates identity U X R.GIHQPAPSFADQAGGNDLLETGIK.V + Deamidated (NQ)
4066   677.5588 2706.2061 2706.1814 9.14 1 23 0.0093 +1Score > 36 indicates identity
Score > 15 indicates homology		 U X K.IQENSKPISDSNAIAQCGTIAAGNDE.E + 4 Deamidated (NQ)
4191   703.1405 2808.5329 2808.5445 -4.14 1 3 1.1 +3Score > 32 indicates identity
Score > 16 indicates homology		 U X K.LSNLQAMIPILESVIQSGKPLLIIAE.D + 3 Deamidated (NQ); Oxidation (M)
4724   961.9969 3843.9585 3843.9055 13.8 1 27 0.0036 +1Score > 33 indicates identity
Score > 15 indicates homology		 U X K.EGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSR.D + Deamidated (NQ)

+101 subsets and intersections (1515 subset proteins in total)

+3

Accession Score Description
Family member distances as a dendrogram 1 ATPA_PSEPG 522 ATP synthase subunit alpha OS=Pseudomonas putida (strain GB-1) GN=atpA PE=3 SV=1
2 ATPA_RICAH 112 ATP synthase subunit alpha OS=Rickettsia akari (strain Hartford) GN=atpA PE=3 SV=1

+4

Accession Score Description
1 ARCA_PSEPK 463 Arginine deiminase OS=Pseudomonas putida (strain KT2440) GN=arcA PE=3 SV=1

+5

Accession Score Description
1 OTCC_PSEPK 391 Ornithine carbamoyltransferase, catabolic OS=Pseudomonas putida (strain KT2440) GN=arcB PE=3 SV=3

+6

Accession Score Description
Family member distances as a dendrogram 1 RPOC_PSEPG 350 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain GB-1) GN=rpoC PE=3 SV=1
2 RPOC_PSEA7 244 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas aeruginosa (strain PA7) GN=rpoC PE=3 SV=1
3 FTSZ_PSEPK 95 Cell division protein ftsZ OS=Pseudomonas putida (strain KT2440) GN=ftsZ PE=3 SV=3

+7

Accession Score Description
1 DLDH2_PSEPU 349 Dihydrolipoamide dehydrogenase OS=Pseudomonas putida GN=lpdG PE=1 SV=4

+8

Accession Score Description
1 ADHP_ECOLI 327 Alcohol dehydrogenase, propanol-preferring OS=Escherichia coli (strain K12) GN=adhP PE=1 SV=1

+9

Accession Score Description
1 ACON2_PSEAE 321 Aconitate hydratase 2 OS=Pseudomonas aeruginosa GN=acnB PE=3 SV=1

+10

Accession Score Description
1 SUCC_PSEPK 313 Succinyl-CoA ligase [ADP-forming] subunit beta OS=Pseudomonas putida (strain KT2440) GN=sucC PE=3 SV=1
Page: 1 2 3 4 5 6 … 25 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/