MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | Rita2 sp |
| MS data file | : | PRT1270_T-BRSC_2_20250714115216.mgf |
| Database | : | SwissProt 57.15 (515,203 sequences; 181,334,896 residues) |
| Timestamp | : | 12 Aug 2025 at 23:39:15 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | GluC_Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,778 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 223 |
503.3218 | 502.3145 | 502.3115 | 6.03 | 0 | 17 | 0.52 | 1Score > 46 indicates identity Score > 27 indicates homology |
AVSVK |
| 358 |
315.1856 | 628.3566 | 628.3544 | 3.53 | 0 | 17 | 0.77 | 1Score > 37 indicates identity Score > 28 indicates homology |
LGGGTPK |
| 1626 |
393.8890 | 1178.6452 | 1178.6230 | 18.8 | 1 | 17 | 0.24 | 1Score > 38 indicates identity Score > 23 indicates homology |
MRDASFAILR |
| 3064 |
945.0104 | 1888.0062 | 1888.0339 | -14.7 | 1 | 17 | 0.57 | 1Score > 38 indicates identity Score > 27 indicates homology |
QTDLVVAMAKTGAIINVK + Deamidated (NQ); Oxidation (M) |
| 2496 |
797.4012 | 1592.7878 | 1592.7933 | -3.44 | 1 | 17 | 0.7 | 1Score > 41 indicates identity Score > 28 indicates homology |
SSIQYLLAQLEAGAE + Deamidated (NQ) |
| 2651 |
829.9395 | 1657.8644 | 1657.8675 | -1.86 | 0 | 17 | 0.47 | 1Score > 40 indicates identity Score > 26 indicates homology |
VQSQNGIVLSWSVIE |
| 1208 |
495.2819 | 988.5492 | 988.5488 | 0.49 | 1 | 17 | 0.81 | 1Score > 40 indicates identity Score > 29 indicates homology |
MLLGDLRR + Oxidation (M) |
| 645 |
382.2102 | 762.4058 | 762.3945 | 14.8 | 1 | 17 | 0.93 | 1Score > 43 indicates identity Score > 29 indicates homology |
MIENIK + Oxidation (M) |
| 1971 |
671.3826 | 1340.7506 | 1340.7452 | 4.06 | 1 | 17 | 0.49 | 1Score > 38 indicates identity Score > 26 indicates homology |
GKLSAVYIAYTR |
| 489 |
348.1718 | 694.3290 | 694.3286 | 0.67 | 1 | 17 | 0.73 | 1Score > 41 indicates identity Score > 28 indicates homology |
IYEDR |
| 384 |
322.7095 | 643.4044 | 643.4017 | 4.24 | 0 | 17 | 0.76 | 1Score > 42 indicates identity Score > 28 indicates homology |
AVVVTR |
| 3201 |
667.0068 | 1997.9986 | 1997.9656 | 16.5 | 0 | 17 | 0.31 | 1Score > 39 indicates identity Score > 24 indicates homology |
LDYLAPMSNNLGYVLAVE + Deamidated (NQ); Oxidation (M) |
| 536 |
357.2201 | 712.4256 | 712.4232 | 3.50 | 0 | 17 | 0.45 | 1Score > 37 indicates identity Score > 26 indicates homology |
SPIIQR |
| 516 |
352.1927 | 702.3708 | 702.3847 | -19.7 | 1 | 17 | 0.95 | 1Score > 43 indicates identity Score > 29 indicates homology |
KMTAPR |
| 319 |
307.6798 | 613.3450 | 613.3548 | -15.8 | 0 | 17 | 0.96 | 1Score > 37 indicates identity Score > 29 indicates homology |
AVATPR |
| 1388 |
356.8545 | 1067.5417 | 1067.5499 | -7.69 | 0 | 17 | 0.51 | 1Score > 40 indicates identity Score > 27 indicates homology |
QHIDTLVLE + Deamidated (NQ) |
| 3394 |
706.0322 | 2115.0748 | 2115.0670 | 3.67 | 0 | 17 | 0.17 | 1Score > 39 indicates identity Score > 22 indicates homology |
AMIDQVAAVGILQSWLDQR + 2 Deamidated (NQ) |
| 1621 |
589.2996 | 1176.5846 | 1176.6060 | -18.1 | 1 | 17 | 0.64 | 1Score > 42 indicates identity Score > 27 indicates homology |
ALAKLDISAME + Oxidation (M) |
| 2633 |
825.9313 | 1649.8480 | 1649.8624 | -8.72 | 0 | 17 | 0.48 | 1Score > 40 indicates identity Score > 26 indicates homology |
ITTVQAAIDFIQSSR + Deamidated (NQ) |
| 3317 |
690.3627 | 2068.0663 | 2068.0915 | -12.2 | 0 | 17 | 0.46 | 1Score > 38 indicates identity Score > 26 indicates homology |
GGLHLIFMDLQLPVLSGIE + Deamidated (NQ); Oxidation (M) |
| 3800 |
794.0995 | 2379.2767 | 2379.2885 | -4.99 | 0 | 17 | 0.12 | 1Score > 35 indicates identity Score > 20 indicates homology |
FGIGADGVLFLAKPLHTSLHMR |
| 1120 |
476.2507 | 950.4868 | 950.4821 | 4.99 | 1 | 17 | 0.69 | 1Score > 41 indicates identity Score > 28 indicates homology |
AGQYRNIK + 2 Deamidated (NQ) |
| 507 |
351.7018 | 701.3890 | 701.3894 | -0.53 | 0 | 17 | 0.83 | 1Score > 42 indicates identity Score > 28 indicates homology |
VPLMAR + Oxidation (M) |
| 1331 |
518.3000 | 1034.5854 | 1034.5760 | 9.10 | 1 | 17 | 0.84 | 1Score > 38 indicates identity Score > 29 indicates homology |
LALEVFTSR |
| 1870 |
647.3227 | 1292.6308 | 1292.6500 | -14.8 | 1 | 17 | 0.17 | 1Score > 41 indicates identity Score > 21 indicates homology |
DAILVNVYQEK + 2 Deamidated (NQ) |
| 3001 |
619.3321 | 1854.9745 | 1855.0051 | -16.5 | 0 | 17 | 0.49 | 1Score > 38 indicates identity Score > 26 indicates homology |
VLTSDSNIVPVDISGIAR |
| 515 |
351.7327 | 701.4508 | 701.4476 | 4.63 | 0 | 17 | 0.21 | 1Score > 35 indicates identity Score > 23 indicates homology |
VPIFVK |
| 1939 |
663.4163 | 1324.8180 | 1324.8078 | 7.72 | 1 | 17 | 0.17 | 1Score > 29 indicates identity Score > 22 indicates homology |
NVVVVAANGKILK + Deamidated (NQ) |
| 1687 |
602.8407 | 1203.6668 | 1203.6645 | 1.93 | 1 | 17 | 0.88 | 1Score > 39 indicates identity Score > 29 indicates homology |
IISMQKGGNLK + Oxidation (M) |
| 2087 |
464.2610 | 1389.7612 | 1389.7504 | 7.79 | 1 | 17 | 0.67 | 1Score > 39 indicates identity Score > 27 indicates homology |
GLFVAISNQEIAK + Deamidated (NQ) |
| 2835 |
879.9941 | 1757.9736 | 1757.9411 | 18.5 | 1 | 17 | 0.85 | 1Score > 36 indicates identity Score > 29 indicates homology |
QLNILTQTVSILEQR + 3 Deamidated (NQ) |
| 3679 |
763.4351 | 2287.2835 | 2287.2827 | 0.32 | 0 | 17 | 0.11 | 1Score > 32 indicates identity Score > 20 indicates homology |
VLFLQGGASLQFSAIPLNLLGK + 2 Deamidated (NQ) |
| 564 |
364.2143 | 726.4140 | 726.4276 | -18.6 | 0 | 17 | 0.65 | 1Score > 39 indicates identity Score > 27 indicates homology |
IDPALAK |
| 1333 |
519.2748 | 1036.5350 | 1036.5488 | -13.2 | 1 | 17 | 0.94 | 1Score > 41 indicates identity Score > 29 indicates homology |
LAAAFKMNR + Oxidation (M) |
| 3173 |
662.0075 | 1983.0007 | 1982.9850 | 7.90 | 0 | 17 | 0.069 | 1Score > 40 indicates identity Score > 18 indicates homology |
VNFAVQAFAALNSNNFVR + 2 Deamidated (NQ) |
| 1052 |
465.2776 | 928.5406 | 928.5229 | 19.1 | 1 | 17 | 0.94 | 1Score > 41 indicates identity Score > 29 indicates homology |
NLLEAQIK + Deamidated (NQ) |
| 2383 |
772.4099 | 1542.8052 | 1542.8140 | -5.70 | 0 | 17 | 0.36 | 1Score > 40 indicates identity Score > 25 indicates homology |
LAIQNSQIASAIALE + 2 Deamidated (NQ) |
| 430 |
336.2200 | 670.4254 | 670.4126 | 19.2 | 1 | 17 | 0.35 | 1Score > 40 indicates identity Score > 25 indicates homology |
RVTAPK |
| 1688 |
603.2932 | 1204.5718 | 1204.5684 | 2.90 | 1 | 17 | 0.5 | 1Score > 41 indicates identity Score > 26 indicates homology |
RQQSTVNNGAK + 3 Deamidated (NQ) |
| 2270 |
747.8832 | 1493.7518 | 1493.7362 | 10.5 | 0 | 17 | 0.86 | 1Score > 41 indicates identity Score > 28 indicates homology |
QVTLLGQNVNSYR + 3 Deamidated (NQ) |
| 4532 |
836.4600 | 3341.8109 | 3341.8210 | -3.01 | 1 | 17 | 0.059 | 1Score > 31 indicates identity Score > 17 indicates homology |
LNHNHMLLWLLLIGTVPVGIAGLLFNKQAE + 2 Deamidated (NQ); Oxidation (M) |
| 432 |
336.2271 | 670.4396 | 670.4377 | 2.84 | 0 | 17 | 0.54 | 1Score > 37 indicates identity Score > 26 indicates homology |
VAGAILK |
| 307 |
602.3538 | 601.3465 | 601.3435 | 5.04 | 1 | 17 | 0.76 | 1Score > 45 indicates identity Score > 28 indicates homology |
AEAIAK |
| 2192 |
722.3881 | 1442.7616 | 1442.7617 | -0.0069 | 1 | 17 | 0.16 | 1Score > 40 indicates identity Score > 21 indicates homology |
SATTVDAEVLAAAPK |
| 1319 |
345.5025 | 1033.4857 | 1033.4862 | -0.55 | 0 | 17 | 0.74 | 1Score > 41 indicates identity Score > 28 indicates homology |
GMADVAQIGR + Deamidated (NQ); Oxidation (M) |
| 2941 |
604.3607 | 1810.0603 | 1810.0452 | 8.35 | 0 | 17 | 0.55 | 1Score > 30 indicates identity Score > 26 indicates homology |
SGSIDLIIIDSVAALVPK |
| 3311 |
687.3587 | 2059.0543 | 2059.0143 | 19.4 | 1 | 17 | 0.56 | 1Score > 39 indicates identity Score > 27 indicates homology |
TTDLQTTLQLSMKAIQHE + 2 Deamidated (NQ) |
| 303 |
301.1702 | 600.3258 | 600.3344 | -14.2 | 0 | 17 | 0.84 | 1Score > 39 indicates identity Score > 28 indicates homology |
AGAGGLR |
| 1242 |
501.3069 | 1000.5992 | 1000.6029 | -3.65 | 1 | 17 | 0.63 | 1Score > 37 indicates identity Score > 27 indicates homology |
LTGISIRNK |
| 587 |
366.7075 | 731.4004 | 731.3926 | 10.7 | 1 | 17 | 0.99 | 1Score > 41 indicates identity Score > 29 indicates homology |
SVGADRK |
| 3397 |
706.0627 | 2115.1663 | 2115.1245 | 19.7 | 1 | 17 | 0.72 | 1Score > 34 indicates identity Score > 28 indicates homology |
QANSSIIISASEMQVPSLLK |
| 2384 |
772.4127 | 1542.8108 | 1542.8154 | -2.96 | 1 | 16 | 0.097 | 1Score > 40 indicates identity Score > 19 indicates homology |
IALDNLQGWVTRR + 2 Deamidated (NQ) |
| 1026 |
462.2719 | 922.5292 | 922.5236 | 6.12 | 1 | 16 | 0.81 | 1Score > 36 indicates identity Score > 28 indicates homology |
IVPPVNER |
| 854 |
427.7420 | 853.4694 | 853.4657 | 4.36 | 0 | 16 | 0.13 | 1Score > 37 indicates identity Score > 20 indicates homology |
APAAAPAASK |
| 921 |
441.2478 | 880.4810 | 880.4767 | 4.99 | 1 | 16 | 0.52 | 1Score > 38 indicates identity Score > 26 indicates homology |
QVHKLGAE |
| 2085 |
695.8818 | 1389.7490 | 1389.7616 | -9.02 | 0 | 16 | 0.78 | 1Score > 40 indicates identity Score > 28 indicates homology |
LQYAGLLSQLQR + Deamidated (NQ) |
| 2274 |
747.8842 | 1493.7538 | 1493.7435 | 6.90 | 1 | 16 | 0.65 | 1Score > 41 indicates identity Score > 27 indicates homology |
YIDNKITMAIPAE + Oxidation (M) |
| 2392 |
515.6051 | 1543.7935 | 1543.7855 | 5.15 | 1 | 16 | 0.92 | 1Score > 41 indicates identity Score > 29 indicates homology |
QAQRVGQPYVNQR + Deamidated (NQ) |
| 3234 |
1010.5093 | 2019.0040 | 2019.0056 | -0.79 | 1 | 16 | 0.67 | 1Score > 40 indicates identity Score > 27 indicates homology |
LESIVMNWLGQMLNLPK + 2 Deamidated (NQ); 2 Oxidation (M) |
| 919 |
440.7258 | 879.4370 | 879.4450 | -9.05 | 1 | 16 | 0.86 | 1Score > 42 indicates identity Score > 28 indicates homology |
TEPYRSK |
| 2271 |
747.8839 | 1493.7532 | 1493.7435 | 6.50 | 1 | 16 | 0.65 | 1Score > 41 indicates identity Score > 27 indicates homology |
YIDNKITMAIPAE + Oxidation (M) |
| 3320 |
692.3568 | 2074.0486 | 2074.0378 | 5.20 | 1 | 16 | 0.74 | 1Score > 39 indicates identity Score > 28 indicates homology |
NLGQAMPGVSNLDVRFSNR |
| 1449 |
550.3130 | 1098.6114 | 1098.6298 | -16.7 | 1 | 16 | 0.44 | 1Score > 40 indicates identity Score > 25 indicates homology |
QQVLLWRR + Deamidated (NQ) |
| 1729 |
408.5609 | 1222.6609 | 1222.6669 | -4.97 | 1 | 16 | 0.7 | 1Score > 39 indicates identity Score > 27 indicates homology |
VQIHAQQKLR + 3 Deamidated (NQ) |
| 2415 |
519.3005 | 1554.8797 | 1554.8558 | 15.3 | 1 | 16 | 0.68 | 1Score > 36 indicates identity Score > 27 indicates homology |
RFPVALALSAPVWE |
| 1459 |
552.8303 | 1103.6460 | 1103.6260 | 18.1 | 1 | 16 | 0.72 | 1Score > 36 indicates identity Score > 27 indicates homology |
KVVLLGMSLE + Oxidation (M) |
| 830 |
423.7285 | 845.4424 | 845.4541 | -13.8 | 1 | 16 | 0.83 | 1Score > 42 indicates identity Score > 28 indicates homology |
IPGRMTR + Oxidation (M) |
| 2116 |
703.3406 | 1404.6666 | 1404.6779 | -8.02 | 1 | 16 | 0.095 | 1Score > 41 indicates identity Score > 19 indicates homology |
AAARMADDLASAAR + Oxidation (M) |
| 1566 |
385.5659 | 1153.6759 | 1153.6567 | 16.6 | 1 | 16 | 0.31 | 1Score > 36 indicates identity Score > 24 indicates homology |
ITGINDPRLR |
| 2287 |
749.9401 | 1497.8656 | 1497.8402 | 17.0 | 1 | 16 | 0.25 | 1Score > 35 indicates identity Score > 23 indicates homology |
ISIAGRLVADLLQE + Deamidated (NQ) |
| 374 |
637.3322 | 636.3249 | 636.3231 | 2.86 | 1 | 16 | 0.92 | 1Score > 41 indicates identity Score > 28 indicates homology |
EIGYR |
| 1819 |
635.3832 | 1268.7518 | 1268.7565 | -3.63 | 1 | 16 | 0.93 | 1Score > 35 indicates identity Score > 28 indicates homology |
ILVQVTRNGLR + Deamidated (NQ) |
| 575 |
365.1996 | 728.3846 | 728.3817 | 4.05 | 0 | 16 | 0.76 | 1Score > 39 indicates identity Score > 28 indicates homology |
TQLPGGR + Deamidated (NQ) |
| 2756 |
854.9525 | 1707.8904 | 1707.8827 | 4.53 | 1 | 16 | 0.68 | 1Score > 39 indicates identity Score > 27 indicates homology |
QELLLIIMGGVFVME + Deamidated (NQ); Oxidation (M) |
| 359 |
315.2034 | 628.3922 | 628.4020 | -15.6 | 1 | 16 | 0.3 | 1Score > 42 indicates identity Score > 24 indicates homology |
GGIKVR |
| 2032 |
456.5704 | 1366.6894 | 1366.6915 | -1.53 | 1 | 16 | 0.8 | 1Score > 40 indicates identity Score > 28 indicates homology |
APTMYTVRNIGK + Deamidated (NQ); Oxidation (M) |
| 3332 |
1040.0568 | 2078.0990 | 2078.0579 | 19.8 | 1 | 16 | 0.15 | 1Score > 37 indicates identity Score > 21 indicates homology |
QGGQLMILGSGAPHLEQGIR + Deamidated (NQ); Oxidation (M) |
| 1810 |
633.8359 | 1265.6572 | 1265.6503 | 5.48 | 0 | 16 | 0.097 | 1Score > 40 indicates identity Score > 19 indicates homology |
VTYDIQASLQK + Deamidated (NQ) |
| 3229 |
671.3571 | 2011.0495 | 2011.0262 | 11.6 | 1 | 16 | 0.38 | 1Score > 39 indicates identity Score > 24 indicates homology |
QTLSPSVLIEHLNLFGNE + Deamidated (NQ) |
| 1675 |
400.8650 | 1199.5732 | 1199.5782 | -4.19 | 1 | 16 | 0.72 | 1Score > 40 indicates identity Score > 27 indicates homology |
QASLSRPPESE |
| 3077 |
951.9952 | 1901.9758 | 1901.9557 | 10.6 | 1 | 16 | 0.22 | 1Score > 39 indicates identity Score > 22 indicates homology |
LTSTVAFSSGMGYILAER |
| 3806 |
794.1057 | 2379.2953 | 2379.2885 | 2.83 | 0 | 16 | 0.097 | 1Score > 34 indicates identity Score > 19 indicates homology |
FGIGADGVLFLAKPLHTSLHMR |
| 1877 |
648.3789 | 1294.7432 | 1294.7609 | -13.6 | 1 | 16 | 0.44 | 1Score > 35 indicates identity Score > 25 indicates homology |
VVGLSTQLPPRK + Deamidated (NQ) |
| 2403 |
517.6072 | 1549.7998 | 1549.7810 | 12.1 | 1 | 16 | 0.21 | 1Score > 40 indicates identity Score > 22 indicates homology |
ALIEDPHAIPMTNK + Deamidated (NQ) |
| 2388 |
772.4286 | 1542.8426 | 1542.8374 | 3.39 | 1 | 16 | 0.59 | 1Score > 38 indicates identity Score > 26 indicates homology |
MAVIKMKPTSPGQR |
| 2925 |
902.9734 | 1803.9322 | 1803.9441 | -6.55 | 1 | 16 | 0.073 | 1Score > 40 indicates identity Score > 17 indicates homology |
SPQQIMGVLVKQFLAE + Deamidated (NQ); Oxidation (M) |
| 2555 |
807.9283 | 1613.8420 | 1613.8373 | 2.95 | 1 | 16 | 0.18 | 1Score > 40 indicates identity Score > 21 indicates homology |
QAADDPLNTVSSIKR |
| 2386 |
772.4279 | 1542.8412 | 1542.8439 | -1.73 | 0 | 16 | 0.64 | 1Score > 39 indicates identity Score > 27 indicates homology |
NMVVSNILLNNIAK + Deamidated (NQ) |
| 2770 |
857.4740 | 1712.9334 | 1712.9573 | -13.9 | 1 | 16 | 0.59 | 1Score > 38 indicates identity Score > 26 indicates homology |
FKPVAQQLLNRIQR + 3 Deamidated (NQ) |
| 3128 |
649.3655 | 1945.0747 | 1945.0480 | 13.7 | 0 | 16 | 0.3 | 1Score > 35 indicates identity Score > 23 indicates homology |
LSGSNTVQGASTITQQLIK |
| 1385 |
534.2753 | 1066.5360 | 1066.5546 | -17.4 | 1 | 16 | 0.13 | 1Score > 41 indicates identity Score > 20 indicates homology |
KITFLTNTE + Deamidated (NQ) |
| 1836 |
320.1807 | 1276.6937 | 1276.6962 | -1.92 | 1 | 16 | 0.11 | 1Score > 39 indicates identity Score > 19 indicates homology |
FLKNTALPAMR + Oxidation (M) |
| 2177 |
717.8654 | 1433.7162 | 1433.7150 | 0.85 | 1 | 16 | 0.73 | 1Score > 42 indicates identity Score > 27 indicates homology |
IQQTFAALAEQGR + 2 Deamidated (NQ) |
| 1760 |
617.3163 | 1232.6180 | 1232.6109 | 5.79 | 1 | 16 | 0.34 | 1Score > 42 indicates identity Score > 24 indicates homology |
RLSGALDSGDSR |
| 1918 |
660.3082 | 1318.6018 | 1318.6153 | -10.2 | 0 | 16 | 0.21 | 1Score > 40 indicates identity Score > 22 indicates homology |
TLDISDADWQR |
| 1667 |
399.8961 | 1196.6665 | 1196.6553 | 9.32 | 1 | 16 | 0.74 | 1Score > 38 indicates identity Score > 27 indicates homology |
AIAFLRYTNK + Deamidated (NQ) |
| 2903 |
897.9681 | 1793.9216 | 1793.9346 | -7.19 | 1 | 16 | 0.086 | 1Score > 40 indicates identity Score > 18 indicates homology |
GGSNLIPLEGLLPCTPR + Deamidated (NQ) |
| 2152 |
712.3619 | 1422.7092 | 1422.7354 | -18.4 | 1 | 16 | 0.4 | 1Score > 41 indicates identity Score > 25 indicates homology |
LQSQIQSKFQSK + 2 Deamidated (NQ) |
| 3049 |
627.9626 | 1880.8660 | 1880.8495 | 8.74 | 0 | 16 | 0.069 | 1Score > 39 indicates identity Score > 17 indicates homology |
LQAIIVNSGNANACTGMK + 4 Deamidated (NQ); Oxidation (M) |
| 1579 |
579.7753 | 1157.5360 | 1157.5499 | -12.0 | 1 | 16 | 0.14 | 1Score > 40 indicates identity Score > 20 indicates homology |
VKVHDMNNGK + Deamidated (NQ); Oxidation (M) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/