MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita2 sp
MS data file : PRT1270_T-BRSC_2_20250714115216.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:39:15 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,778

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 2501–2600 (out of 3643)

Page: Previous 1 …21 22 23 24 25 26 27 28 29 30 31 … 37 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4425 795.9383 3179.7241 3179.7186 1.74 1 2 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 MVIQPSLLLLLLLTLQDVDSCQGPELVR + Deamidated (NQ); Oxidation (M)
4429 796.3970 3181.5589 3181.6105 -16.2 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 VTGVNTELLNMLVQGDFIPVIAPIGVGPDGE + 2 Deamidated (NQ); Oxidation (M)
4133 922.1378 2763.3916 2763.4331 -15.0 1 2 0.91 +1Score > 37 indicates identity
Score > 14 indicates homology		 DQAFVSSLVPNYGGTLDIIGGVVVESK
2163 714.4261 1426.8376 1426.8143 16.3 1 2 1 +1Score > 34 indicates identity
Score > 15 indicates homology		 GAIRQGLQTLLQK + 2 Deamidated (NQ)
2684 557.3375 1668.9907 1668.9847 3.55 1 2 0.8 +1Score > 30 indicates identity
Score > 14 indicates homology		 ALSLAKPIIQMLKNK + 2 Deamidated (NQ)
3822 599.2961 2393.1553 2393.1104 18.8 1 2 0.8 +1Score > 39 indicates identity
Score > 14 indicates homology		 SLAPGGCLAVQMPDNLEEPSHR + Oxidation (M)
4382 774.9144 3095.6285 3095.5882 13.0 1 2 0.93 +1Score > 34 indicates identity
Score > 14 indicates homology		 LAAIAGVLACNPDVLIMDEPTASLDAQAKK + Deamidated (NQ)
3606 744.7383 2231.1931 2231.2018 -3.90 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 VMVMKIAVIGGTGDQGLGLALR + Deamidated (NQ); 2 Oxidation (M)
4547 1124.5901 3370.7485 3370.7844 -10.7 0 2 0.68 +1Score > 34 indicates identity
Score > 13 indicates homology		 TTAGAPAAAPAAVPAGTTAAAAAAAAAAAAAAAAVTSGVAPK
3302 686.0129 2055.0169 2054.9996 8.40 1 2 0.86 +1Score > 40 indicates identity
Score > 14 indicates homology		 NLFLVGDNNQMIYRWR + Deamidated (NQ); Oxidation (M)
3963 849.4393 2545.2961 2545.3322 -14.2 1 2 0.93 +1Score > 38 indicates identity
Score > 14 indicates homology		 NSMLLHTAEGHDVAVIQIAGLLAR + Deamidated (NQ); Oxidation (M)
3367 1050.5345 2099.0544 2099.0326 10.4 1 2 0.65 +1Score > 39 indicates identity
Score > 13 indicates homology		 MTGGGMRQSGILAAAGMYALK + Oxidation (M)
3782 787.7590 2360.2552 2360.2376 7.44 1 2 0.87 +1Score > 36 indicates identity
Score > 14 indicates homology		 VKSVTLLQHQSGYFPDAVTLR + 2 Deamidated (NQ)
3976 853.7520 2558.2342 2558.1959 15.0 1 2 1 +1Score > 38 indicates identity
Score > 15 indicates homology		 AGDNAPMAYVELVDRPVGGSVEPAE + Oxidation (M)
4629 957.9705 3827.8529 3827.8741 -5.55 1 2 0.84 +1Score > 34 indicates identity
Score > 14 indicates homology		 AKQLVDNGLGIIDWASTDQGSEPDIVFAAAGTEPTLE
4408 1050.5531 3148.6375 3148.6616 -7.65 0 2 0.87 +1Score > 34 indicates identity
Score > 14 indicates homology		 DATVSAASVIAAALAVGLAAIGPGIGQGTAAGQAVE + Deamidated (NQ)
4155 929.8713 2786.5921 2786.5656 9.51 1 2 1 +1Score > 29 indicates identity
Score > 15 indicates homology		 VLDSLISFGIHPLQIMKILSSYALK + Deamidated (NQ)
4394 1042.5048 3124.4926 3124.5160 -7.50 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 TNSTTTIINNNTQNNFTNITNIIVSKNE + 2 Deamidated (NQ)
3586 739.7032 2216.0878 2216.0929 -2.33 1 2 0.8 +1Score > 39 indicates identity
Score > 14 indicates homology		 AVTMGGTMPAVLNAANEVAVQR + Deamidated (NQ); Oxidation (M)
3793 594.0939 2372.3465 2372.3355 4.62 1 2 0.92 +1Score > 30 indicates identity
Score > 14 indicates homology		 ILSKLGVTTSWFDPLIGADIVK
4516 662.3732 3306.8296 3306.8056 7.26 1 2 1 +1Score > 29 indicates identity
Score > 15 indicates homology		 YPPSIGSILLIIPIFLTFFGNSNAQLWKR + 2 Deamidated (NQ)
4232 961.1355 2880.3847 2880.3971 -4.30 1 2 0.96 +1Score > 37 indicates identity
Score > 14 indicates homology		 SAGDFDIFFPVVHGNLGEDGTLQGLFK + Deamidated (NQ)
3261 1018.0375 2034.0604 2034.0211 19.4 1 2 0.66 +1Score > 38 indicates identity
Score > 13 indicates homology		 SLPFFFVSIGNIPSHRSE + Deamidated (NQ)
3918 832.4362 2494.2868 2494.2955 -3.51 1 2 0.74 +1Score > 37 indicates identity
Score > 13 indicates homology		 QLVASTNQGVVDQEIPVFNLPPK + 2 Deamidated (NQ)
3795 594.0941 2372.3473 2372.3442 1.30 1 2 1 +1Score > 30 indicates identity
Score > 15 indicates homology		 MPAFNRLLPLASLVLIYWVR + Deamidated (NQ)
4002 862.1154 2583.3244 2583.3730 -18.8 1 2 0.84 +1Score > 37 indicates identity
Score > 14 indicates homology		 LGLSGMAIADITLLSGFHALRADLE
4270 977.8680 2930.5822 2930.5362 15.7 1 2 0.9 +1Score > 33 indicates identity
Score > 14 indicates homology		 FILLHHHDNDTILDTLLTRISSNSR
3675 760.4029 2278.1869 2278.1667 8.85 1 2 0.89 +1Score > 38 indicates identity
Score > 14 indicates homology		 KLNLASYHQLTFMKPDINK + 2 Deamidated (NQ); Oxidation (M)
4361 1023.4727 3067.3963 3067.4458 -16.2 0 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 SSVFSRPSTGGAMGHQSFFTQVPSAAGVPR + 2 Deamidated (NQ); Oxidation (M)
4628 766.3843 3826.8851 3826.8578 7.15 1 2 0.84 +1Score > 34 indicates identity
Score > 14 indicates homology		 FSNQPVVIDNGSGVIKAGFAGQDPPSHIFQSLVGNPK + 6 Deamidated (NQ)
2062 692.8231 1383.6316 1383.6374 -4.17 0 2 0.89 +1Score > 40 indicates identity
Score > 14 indicates homology		 VVSSGVTGAMDMAK + 2 Oxidation (M)
2837 586.9996 1757.9770 1757.9577 11.0 1 2 0.88 +1Score > 36 indicates identity
Score > 14 indicates homology		 QLWAHLVGKGAIPDPR + Deamidated (NQ)
3478 718.7631 2153.2675 2153.2419 11.9 1 2 0.88 +1Score > 26 indicates identity
Score > 14 indicates homology		 TALQVNLNGLLQTTDKIALK
4058 896.4402 2686.2988 2686.3312 -12.1 1 2 0.93 +1Score > 38 indicates identity
Score > 14 indicates homology		 HQIQPIDMVVVNLYPFAQTVARE + 3 Deamidated (NQ); Oxidation (M)
3044 626.3420 1876.0042 1875.9915 6.76 1 2 0.85 +1Score > 37 indicates identity
Score > 14 indicates homology		 QRPAPNTAPTDPTLRNK
4166 931.5291 2791.5655 2791.5232 15.2 1 2 1 +1Score > 30 indicates identity
Score > 15 indicates homology		 IANIIHQNLASPQNILAVTFTNKAAK + 2 Deamidated (NQ)
2456 315.7943 1573.9351 1573.9191 10.2 1 2 0.77 +1Score > 30 indicates identity
Score > 13 indicates homology		 ALEPHVQVLAKQIK + Deamidated (NQ)
3525 728.3747 2182.1023 2182.1117 -4.32 1 2 0.86 +1Score > 39 indicates identity
Score > 14 indicates homology		 ALDAADGAQAAAQLAVVRQLVE + 3 Deamidated (NQ)
3979 855.1320 2562.3742 2562.3661 3.13 0 2 0.66 +1Score > 35 indicates identity
Score > 13 indicates homology		 TNKPSKPLNPMINAGALAVTHMIK + Deamidated (NQ); Oxidation (M)
4226 959.5050 2875.4932 2875.4790 4.93 1 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 VVDSSPLVPRNDPTLLFVNSGMVQFK + Deamidated (NQ); Oxidation (M)
4697 1085.5707 4338.2537 4338.3272 -16.9 1 2 0.71 +1Score > 30 indicates identity
Score > 13 indicates homology		 LAAFNADVMVVAAYGLILPQIVLDTPKYGCLNIHGSLLPR + Oxidation (M)
4533 836.4626 3341.8213 3341.8084 3.87 1 2 0.89 +1Score > 30 indicates identity
Score > 14 indicates homology		 IVEPLLDELLAADVVLIGTPMYNYSIPAALK + Deamidated (NQ)
2767 429.2143 1712.8281 1712.8178 5.99 0 2 0.75 +1Score > 40 indicates identity
Score > 13 indicates homology		 LSLQDSLQISFDSMK + 2 Deamidated (NQ)
4171 934.8432 2801.5078 2801.5401 -11.5 0 2 0.71 +1Score > 33 indicates identity
Score > 13 indicates homology		 SLMIFFHIVLLAVSLSNNIILTSGAE
522 704.3703 703.3630 703.3574 7.94 1 2 0.95 +1Score > 44 indicates identity
Score > 14 indicates homology		 EIMPSK
3121 646.0259 1935.0559 1935.0724 -8.53 1 2 0.69 +1Score > 36 indicates identity
Score > 13 indicates homology		 MLLGVNIDHIAVLRQAR + Deamidated (NQ); Oxidation (M)
4356 1021.5301 3061.5685 3061.6012 -10.7 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 SRSGLGLGIGISFFATLVSQLLVYNGVYE + 2 Deamidated (NQ)
4413 1055.5161 3163.5265 3163.4703 17.8 1 2 0.89 +1Score > 36 indicates identity
Score > 14 indicates homology		 QSEFLVCSGGGSYDSGAMALVVNHHGDIIK + Oxidation (M)
2639 826.4354 1650.8562 1650.8465 5.93 1 2 1 +1Score > 40 indicates identity
Score > 14 indicates homology		 ITTVQAAIDYVSKNQ + Deamidated (NQ)
3491 1083.5773 2165.1400 2165.1619 -10.1 0 2 0.75 +1Score > 37 indicates identity
Score > 13 indicates homology		 IAVNLNNQLISLTFTNFLK + 3 Deamidated (NQ)
3903 827.4507 2479.3303 2479.3607 -12.3 1 2 0.91 +1Score > 35 indicates identity
Score > 14 indicates homology		 LAGRDPNTLIGLPLIALTQMLIE + 2 Deamidated (NQ); Oxidation (M)
3779 786.7628 2357.2666 2357.3066 -17.0 1 2 0.93 +1Score > 35 indicates identity
Score > 14 indicates homology		 LDIANHQIRILRPALLSNAVE + 2 Deamidated (NQ)
4353 611.7254 3053.5906 3053.5613 9.61 0 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 TNIACTPAGPFAGPMVVSMRPLKPADAIR + Oxidation (M)
4577 709.1532 3540.7296 3540.7235 1.72 1 2 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 LCPYDQVKVVILGQDPYHGPGQAHGLSFSVQK + 4 Deamidated (NQ)
3048 941.0104 1880.0062 1880.0115 -2.81 1 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 AQAAQPAAKGAGSKPQGLTK + Deamidated (NQ)
3971 852.1191 2553.3355 2553.2930 16.6 1 2 0.68 +1Score > 36 indicates identity
Score > 13 indicates homology		 LNSSVVRSQMLQNLFLINNAMK + 2 Deamidated (NQ); 2 Oxidation (M)
3987 643.0660 2568.2349 2568.2483 -5.20 1 2 0.79 +1Score > 38 indicates identity
Score > 13 indicates homology		 AGVNEQLNQLVVDDLTLFNAYTK + 4 Deamidated (NQ)
4326 1006.5757 3016.7053 3016.7253 -6.64 1 2 1 +1Score > 28 indicates identity
Score > 14 indicates homology		 VKTLSVPAFISGIFGVTEPAIYGVTLPLK
4507 551.8115 3304.8253 3304.8225 0.87 0 2 0.78 +1Score > 30 indicates identity
Score > 13 indicates homology		 MNNNQQILLWALIIFIPFLAILWLIFK + 4 Deamidated (NQ); Oxidation (M)
2671 834.4666 1666.9186 1666.9083 6.22 0 2 0.82 +1Score > 37 indicates identity
Score > 14 indicates homology		 LLINGGTISPFFFNK
4456 1070.5717 3208.6933 3208.6570 11.3 1 2 0.78 +1Score > 33 indicates identity
Score > 13 indicates homology		 LLFLGGPASSAYALSPFSASGGWGRAGHLHPK
885 865.4495 864.4422 864.4341 9.37 0 2 0.77 +1Score > 42 indicates identity
Score > 13 indicates homology		 QLDSFQK
4472 1078.8306 3233.4700 3233.4651 1.50 1 2 0.73 +1Score > 35 indicates identity
Score > 13 indicates homology		 LLPFPQMLHDVYNNNLQNSYSYQEFR + 4 Deamidated (NQ)
2846 588.6546 1762.9420 1762.9321 5.59 1 2 1 +1Score > 38 indicates identity
Score > 14 indicates homology		 QVGAMKSLTLMVDNIK + Oxidation (M)
4254 728.1336 2908.5053 2908.5005 1.66 0 2 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 QVTAPTVVIVVNNNGGQIFSMLPTPPAE + Oxidation (M)
3528 728.7305 2183.1697 2183.1487 9.60 1 2 0.7 +1Score > 36 indicates identity
Score > 13 indicates homology		 IEPRALQLLGSYDWPGNVR
3703 767.7621 2300.2645 2300.2185 20.0 1 2 0.68 +1Score > 34 indicates identity
Score > 13 indicates homology		 LINLVGELVINQAMLSQSVIE + 2 Deamidated (NQ); Oxidation (M)
4465 806.6738 3222.6661 3222.6345 9.81 1 2 0.86 +1Score > 35 indicates identity
Score > 14 indicates homology		 GFAGLYKGVASPLVGLSIMNSVMFLAYGQSK + 2 Deamidated (NQ); Oxidation (M)
1972 671.9151 1341.8156 1341.8020 10.2 1 2 0.88 +1Score > 30 indicates identity
Score > 14 indicates homology		 KVIDYLLTHIK
3564 1102.5309 2203.0472 2203.0579 -4.85 1 2 0.92 +1Score > 39 indicates identity
Score > 14 indicates homology		 ELQPSADGCFLTVPNINATR + Deamidated (NQ)
4229 960.4850 2878.4332 2878.4640 -10.7 1 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 AETVLLQAGLVYQAIQININLYNWE + 3 Deamidated (NQ)
2949 606.9586 1817.8540 1817.8804 -14.5 0 2 0.89 +1Score > 40 indicates identity
Score > 14 indicates homology		 SNPMLQQTICPFPLR + Deamidated (NQ); Oxidation (M)
3660 756.3922 2266.1548 2266.1806 -11.4 1 2 0.86 +1Score > 38 indicates identity
Score > 14 indicates homology		 IPLISPQNCWLNLVILEIE + 3 Deamidated (NQ)
3981 855.7414 2564.2024 2564.1518 19.7 1 2 0.99 +1Score > 38 indicates identity
Score > 14 indicates homology		 LLMSYLAMITNCTSNMNEVVDK + 2 Deamidated (NQ); Oxidation (M)
4376 1030.8981 3089.6725 3089.6278 14.5 1 2 1 +1Score > 32 indicates identity
Score > 14 indicates homology		 TATMALSTLAALIQISGAKNITLSPDQTSR + Deamidated (NQ); Oxidation (M)
3230 672.7144 2015.1214 2015.1303 -4.41 1 2 0.75 +1Score > 34 indicates identity
Score > 13 indicates homology		 GNPKALIIDIVTQAGTYIK + Deamidated (NQ)
851 427.2015 852.3884 852.3721 19.2 0 2 1 +1Score > 41 indicates identity
Score > 14 indicates homology		 MQVMAQK + 2 Deamidated (NQ); Oxidation (M)
3550 732.3914 2194.1524 2194.1932 -18.6 1 2 1 +1Score > 38 indicates identity
Score > 14 indicates homology		 RLAMTHSVPLHTLYLAIDK + Oxidation (M)
4147 927.4835 2779.4287 2779.4532 -8.81 0 2 0.87 +1Score > 36 indicates identity
Score > 14 indicates homology		 SFPIAVALGADPATILDAVTPVPDTLSE
2058 461.5937 1381.7593 1381.7565 2.01 1 2 0.84 +1Score > 38 indicates identity
Score > 14 indicates homology		 LGLLPGALTRNQE + Deamidated (NQ)
4156 697.8688 2787.4461 2787.4304 5.65 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 SLNAAPPAEPPGPLGPLGAGAAGAPAGGAPER
4391 1040.5430 3118.6072 3118.6299 -7.28 1 2 0.78 +1Score > 35 indicates identity
Score > 13 indicates homology		 LGIPVVAILDSNSDPRGVTFPIPGNDDAIR + Deamidated (NQ)
3411 1060.5726 2119.1306 2119.1313 -0.32 1 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 VVLQLEPVYADLLGRYNR + 2 Deamidated (NQ)
4235 961.8212 2882.4418 2882.4809 -13.6 1 2 0.87 +1Score > 37 indicates identity
Score > 14 indicates homology		 YIISNIDASMAVIIHLGMSGKLIYVE + Deamidated (NQ); 2 Oxidation (M)
4395 782.6374 3126.5205 3126.5326 -3.86 1 2 0.74 +1Score > 36 indicates identity
Score > 13 indicates homology		 LNQPAQITDSVQVMPLPTQEVQVGTTCR + Deamidated (NQ); Oxidation (M)
3933 628.3337 2509.3057 2509.3064 -0.27 1 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 QALPHIGALVLSDYAKGALSQVQE + 2 Deamidated (NQ)
4525 832.6741 3326.6673 3326.6823 -4.50 0 2 0.9 +1Score > 35 indicates identity
Score > 14 indicates homology		 IIQLQNDFLDNAYLHINTIIPGYTHLQR + 4 Deamidated (NQ)
3355 1047.0443 2092.0740 2092.0517 10.7 1 2 1 +1Score > 39 indicates identity
Score > 14 indicates homology		 LDPFSSPINFFIPNENLK + Deamidated (NQ)
4598 908.4940 3629.9469 3629.8852 17.0 1 2 0.7 +1Score > 30 indicates identity
Score > 13 indicates homology		 LIIMKDLGWCLSPMTIVSWFNVFLQVAYIR + Deamidated (NQ); Oxidation (M)
3657 1134.0797 2266.1448 2266.1805 -15.7 1 2 0.99 +1Score > 39 indicates identity
Score > 14 indicates homology		 NPIQDIKITSDTNVPVNAGIR + 2 Deamidated (NQ)
3786 1182.5648 2363.1150 2363.1427 -11.7 1 2 1 +1Score > 39 indicates identity
Score > 14 indicates homology		 ASRGNYLIMPSGNLQIVNASQE + 2 Deamidated (NQ)
4065 898.4252 2692.2538 2692.2724 -6.91 1 2 0.87 +1Score > 37 indicates identity
Score > 14 indicates homology		 ALQQLVADNMAEITAQPAYQMLQE + Deamidated (NQ); Oxidation (M)
4197 944.8105 2831.4097 2831.4099 -0.069 1 2 0.87 +1Score > 37 indicates identity
Score > 14 indicates homology		 KGIPASVSQTAGTFVCNHVMYGLLHK + Deamidated (NQ); Oxidation (M)
4551 1130.9276 3389.7610 3389.7215 11.6 1 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 SGGQLAAVTQWIAAATVSRAEPPQSQPSVEPVR + 2 Deamidated (NQ)
3653 755.4101 2263.2085 2263.2371 -12.7 1 2 0.96 +1Score > 36 indicates identity
Score > 14 indicates homology		 VRQALAIAQAMLIPAGHPPHR + Deamidated (NQ); Oxidation (M)
4162 930.8091 2789.4055 2789.3768 10.3 1 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 WVDGSTWKHLTLVGQAMGSMLLTIE + Deamidated (NQ); Oxidation (M)
4759 801.9232 6407.3274 6407.3142 2.06 1 2 0.76 +1Score > 26 indicates identity
Score > 13 indicates homology		 VTQGVTLMSGMILLTWQKIAPMSILYQISPSINTNLLMLMALTSVLVGGWGGLNQTQLR + 7 Deamidated (NQ)
3164 495.9891 1979.9273 1979.9371 -4.94 1 2 0.75 +1Score > 39 indicates identity
Score > 13 indicates homology		 MSAEPLLPTHNGSQGGEVR + Deamidated (NQ)
3749 776.7460 2327.2162 2327.2008 6.59 1 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 SVLAANLDALVEAQPLPYTNAR + 2 Deamidated (NQ)
4487 652.7529 3258.7281 3258.7329 -1.47 1 2 0.76 +1Score > 33 indicates identity
Score > 13 indicates homology		 HAVIVGASNIVGRPMSLELLLAGATTTVCHR + Oxidation (M)
Page: Previous 1 …21 22 23 24 25 26 27 28 29 30 31 … 37 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/