MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita2 sp
MS data file : PRT1270_T-BRSC_2_20250714115216.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:39:15 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,778

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1901–2000 (out of 3643)

Page: Previous 1 …15 16 17 18 19 20 21 22 23 24 25 … 37 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2500 532.9445 1595.8117 1595.8096 1.30 0 6 0.49 +1Score > 40 indicates identity
Score > 16 indicates homology		 VAIYVNGNYQWLR + Deamidated (NQ)
2556 538.9550 1613.8432 1613.8202 14.3 1 6 0.89 +1Score > 40 indicates identity
Score > 18 indicates homology		 WAVQVLQVAEQWR + 2 Deamidated (NQ)
4319 1000.5363 2998.5871 2998.5521 11.7 1 6 1 +1Score > 34 indicates identity
Score > 19 indicates homology		 DMVFLRQVGLHPIVVHGGGPQISHMLK + 2 Deamidated (NQ); 2 Oxidation (M)
3080 636.2836 1905.8290 1905.8488 -10.4 0 6 0.53 +1Score > 36 indicates identity
Score > 16 indicates homology		 TLQDMMNIIDYNQYK + Deamidated (NQ); Oxidation (M)
3817 797.1450 2388.4132 2388.4041 3.81 0 6 1 +1Score > 25 indicates identity
Score > 19 indicates homology		 ITIPLAVLIVICFMLAAVFIR + Oxidation (M)
2186 481.2469 1440.7189 1440.6918 18.8 0 6 0.69 +1Score > 40 indicates identity
Score > 17 indicates homology		 EPSHLAQTIADMK + Deamidated (NQ)
3358 699.0392 2094.0958 2094.0680 13.3 1 6 0.9 +1Score > 38 indicates identity
Score > 18 indicates homology		 LNYMPNHHAISQLSKVNK + Deamidated (NQ)
123 404.2152 403.2079 403.2067 3.05 0 6 0.59 +1Score > 46 indicates identity
Score > 16 indicates homology		 SVAGA
910 439.2641 876.5136 876.5102 3.89 1 6 0.76 +1Score > 37 indicates identity
Score > 17 indicates homology		 ASMISKLK
3117 645.6633 1933.9681 1934.0044 -18.8 1 6 0.95 +1Score > 40 indicates identity
Score > 18 indicates homology		 RPPTAGSQFKASVATLMR + Deamidated (NQ); Oxidation (M)
2723 848.9338 1695.8530 1695.8250 16.5 1 6 0.68 +1Score > 40 indicates identity
Score > 17 indicates homology		 KVNVGAGTITCNYDGK
3017 932.4565 1862.8984 1862.8832 8.16 1 6 0.76 +1Score > 40 indicates identity
Score > 17 indicates homology		 ANPMAFIVEQAGGAATTGR + 2 Deamidated (NQ)
3076 634.3524 1900.0354 1900.0265 4.66 1 6 0.71 +1Score > 37 indicates identity
Score > 17 indicates homology		 DAISGAKNDVAALSVAIASK
4553 849.9318 3395.6981 3395.6953 0.83 1 6 0.57 +1Score > 35 indicates identity
Score > 16 indicates homology		 ACGTNVTDIVVLVVAADDGIMPQTIESINHVK + Deamidated (NQ); Oxidation (M)
1702 607.3395 1212.6644 1212.6424 18.2 0 6 0.9 +1Score > 40 indicates identity
Score > 18 indicates homology		 MLTIYNTLTK + Oxidation (M)
2208 728.4354 1454.8562 1454.8609 -3.22 1 6 1 +1Score > 33 indicates identity
Score > 19 indicates homology		 SVIGQAVVRVLWK + Deamidated (NQ)
2776 860.4235 1718.8324 1718.8627 -17.6 1 6 0.71 +1Score > 40 indicates identity
Score > 17 indicates homology		 ALQQIDEHLLHWSK + 2 Deamidated (NQ)
3009 465.7140 1858.8269 1858.8632 -19.5 1 6 0.93 +1Score > 38 indicates identity
Score > 18 indicates homology		 SLMDHLGSGKNWDLNR + Deamidated (NQ); Oxidation (M)
3303 686.0141 2055.0205 2055.0169 1.73 0 6 0.82 +1Score > 40 indicates identity
Score > 18 indicates homology		 GLTPNVIIYNMLLGGFCR + 2 Deamidated (NQ); Oxidation (M)
3335 520.5431 2078.1433 2078.1160 13.1 1 6 0.38 +1Score > 34 indicates identity
Score > 14 indicates homology		 VKYLGQLTSVPGYLNPSSR
3717 769.7054 2306.0944 2306.1147 -8.83 1 6 0.4 +1Score > 39 indicates identity
Score > 14 indicates homology		 HQPDIVICVGQAGGRMQITPE + Deamidated (NQ)
3982 642.0782 2564.2837 2564.3057 -8.59 1 6 0.57 +1Score > 38 indicates identity
Score > 16 indicates homology		 AQGETVAFVPTMGNLHQGHITLVK + Deamidated (NQ); Oxidation (M)
4179 702.8956 2807.5533 2807.5605 -2.58 1 6 0.39 +1Score > 31 indicates identity
Score > 14 indicates homology		 LSNLQAMLPILEAVVQTSKPLVIISE + 2 Deamidated (NQ)
2818 870.4771 1738.9396 1738.9465 -3.94 0 6 0.85 +1Score > 38 indicates identity
Score > 18 indicates homology		 LIGSVDDLLPSLPASSR
1701 607.3384 1212.6622 1212.6826 -16.8 0 6 0.4 +1Score > 40 indicates identity
Score > 15 indicates homology		 SLLPAGVTNVSR
3908 829.1673 2484.4801 2484.4865 -2.60 0 6 0.73 +1Score > 24 indicates identity
Score > 17 indicates homology		 SAQLLILSHMVLLQLIVAQLGPK
317 307.1818 612.3490 612.3595 -17.1 1 6 0.94 +1Score > 38 indicates identity
Score > 18 indicates homology		 EIVPR
403 658.3475 657.3402 657.3347 8.42 0 6 0.92 +1Score > 39 indicates identity
Score > 18 indicates homology		 AHFAGR
4210 954.5316 2860.5730 2860.5182 19.2 1 6 0.7 +1Score > 31 indicates identity
Score > 17 indicates homology		 QPLPPTSNQDLGEASLQATLLGLAALNK + Deamidated (NQ)
3647 564.5328 2254.1021 2254.0827 8.59 1 6 0.64 +1Score > 39 indicates identity
Score > 16 indicates homology		 VDDYKIGGGAGLLIQAEPMYE + Oxidation (M)
2429 780.8976 1559.7806 1559.7831 -1.58 1 6 0.85 +1Score > 41 indicates identity
Score > 18 indicates homology		 AAESSFLGQLAPQLE
3686 765.3987 2293.1743 2293.2100 -15.6 1 6 0.96 +1Score > 38 indicates identity
Score > 18 indicates homology		 MTKVSVVGAAGTVGAAAGYNIALR + Deamidated (NQ); Oxidation (M)
2986 922.9545 1843.8944 1843.8588 19.3 1 6 0.81 +1Score > 40 indicates identity
Score > 17 indicates homology		 GQTEAAYSIGLSGSQAFR + 2 Deamidated (NQ)
2621 822.4241 1642.8336 1642.8348 -0.72 1 6 0.8 +1Score > 40 indicates identity
Score > 17 indicates homology		 DRLIPSEPMVTQTR + Deamidated (NQ)
3465 717.0184 2148.0334 2148.0442 -5.04 1 6 0.72 +1Score > 39 indicates identity
Score > 17 indicates homology		 NVNLKSIMGVMSLGIQQNAE + 3 Deamidated (NQ)
2566 808.9401 1615.8656 1615.8569 5.38 1 6 0.48 +1Score > 39 indicates identity
Score > 15 indicates homology		 LAATTALHNSLEFTK
2692 836.9659 1671.9172 1671.9308 -8.10 0 6 0.73 +1Score > 37 indicates identity
Score > 17 indicates homology		 GVLAIVSSPQYAQALR
3529 547.7703 2187.0521 2187.0444 3.54 1 6 0.85 +1Score > 39 indicates identity
Score > 18 indicates homology		 QAADAYLLDNSHLDIESGVR + Deamidated (NQ)
525 354.1787 706.3428 706.3398 4.28 0 6 0.88 +1Score > 41 indicates identity
Score > 18 indicates homology		 GAAAFDR
3348 696.6784 2087.0134 2087.0535 -19.2 1 6 0.81 +1Score > 40 indicates identity
Score > 17 indicates homology		 GTLLAHNDGEVPNLVVNVPE + Deamidated (NQ)
3876 611.2953 2441.1521 2441.1209 12.8 1 6 0.35 +1Score > 38 indicates identity
Score > 14 indicates homology		 YSPDAWMLNYSNPAAIVAEATR + 2 Deamidated (NQ)
2320 378.7181 1510.8433 1510.8296 9.06 1 6 0.88 +1Score > 37 indicates identity
Score > 18 indicates homology		 AFKLLSISGAYWR
3563 1102.0911 2202.1676 2202.1930 -11.5 1 6 0.66 +1Score > 37 indicates identity
Score > 17 indicates homology		 VAGTAAGVTALQMDIKIQGITK + Deamidated (NQ); Oxidation (M)
4302 747.8804 2987.4925 2987.4975 -1.67 1 6 0.54 +1Score > 37 indicates identity
Score > 16 indicates homology		 GGLLVVDASQGVEAQTLANVYLAIDNNLE + 2 Deamidated (NQ)
4261 974.4778 2920.4116 2920.4146 -1.04 1 6 0.5 +1Score > 37 indicates identity
Score > 15 indicates homology		 GQYTHAAIFVGNVSDQLPNMRMMLAR + Deamidated (NQ)
1583 580.3611 1158.7076 1158.7046 2.64 1 6 0.95 +1Score > 31 indicates identity
Score > 18 indicates homology		 SLPLLMITKK + Oxidation (M)
3297 684.3628 2050.0666 2050.0517 7.24 1 6 0.88 +1Score > 38 indicates identity
Score > 18 indicates homology		 GNVVTVMVDVKLNNNVYR + Deamidated (NQ); Oxidation (M)
3931 628.0839 2508.3065 2508.2972 3.70 1 6 0.52 +1Score > 37 indicates identity
Score > 15 indicates homology		 SVSLFEPRPELNHATNAVSIIGR + 2 Deamidated (NQ)
393 651.3058 650.2985 650.2912 11.3 0 6 0.64 +1Score > 43 indicates identity
Score > 16 indicates homology		 AGDLFE
4599 908.7529 3630.9825 3631.0477 -17.9 0 6 1 +1Score > 29 indicates identity
Score > 18 indicates homology		 VQLLGHIFGDIYPSIFHVLALNIAVVGVGVIMAR
1436 546.8092 1091.6038 1091.5975 5.84 1 6 0.99 +1Score > 39 indicates identity
Score > 18 indicates homology		 IFVNSIKNR + 2 Deamidated (NQ)
3110 963.4752 1924.9358 1924.9347 0.62 1 6 0.93 +1Score > 40 indicates identity
Score > 18 indicates homology		 RGVSCSAGSVSMTNGLVVK + Deamidated (NQ); Oxidation (M)
3488 1083.5320 2165.0494 2165.0119 17.3 1 6 0.33 +1Score > 39 indicates identity
Score > 13 indicates homology		 ALMTNAEVIIMDEPTAALTE + Deamidated (NQ); 2 Oxidation (M)
4019 874.4402 2620.2988 2620.2798 7.25 1 6 0.48 +1Score > 38 indicates identity
Score > 15 indicates homology		 VVDASIMPSMVSGNLNAPTIMIAEK + Deamidated (NQ); 2 Oxidation (M)
3923 834.7509 2501.2309 2501.1849 18.4 1 6 0.38 +1Score > 38 indicates identity
Score > 14 indicates homology		 LLNYAQTFGYDIDINIANEALE + 2 Deamidated (NQ)
662 384.7076 767.4006 767.4000 0.85 0 6 0.78 +1Score > 37 indicates identity
Score > 17 indicates homology		 MVIFSR + Oxidation (M)
3585 738.3652 2212.0738 2212.0868 -5.87 0 6 0.93 +1Score > 39 indicates identity
Score > 18 indicates homology		 MQILVNNEPVDALSMLVHR + 2 Deamidated (NQ); 2 Oxidation (M)
3652 754.4044 2260.1914 2260.1699 9.48 1 6 0.71 +1Score > 37 indicates identity
Score > 17 indicates homology		 VVLSASDVLDYGRGDLLTDPR
3683 765.3926 2293.1560 2293.1525 1.52 1 6 0.66 +1Score > 38 indicates identity
Score > 16 indicates homology		 AFNLGVGKNMGWLGAVSLDATR + Deamidated (NQ); Oxidation (M)
591 368.2253 734.4360 734.4326 4.63 0 6 0.78 +1Score > 36 indicates identity
Score > 17 indicates homology		 IALYGAK
926 883.4785 882.4712 882.4633 8.98 0 6 0.68 +1Score > 38 indicates identity
Score > 17 indicates homology		 LLYAMTR + Oxidation (M)
3098 959.5101 1917.0056 1916.9744 16.3 1 6 0.94 +1Score > 38 indicates identity
Score > 18 indicates homology		 WILENQAGRPVYNSLR + 2 Deamidated (NQ)
3273 680.3473 2038.0201 2038.0557 -17.5 1 6 0.46 +1Score > 39 indicates identity
Score > 15 indicates homology		 LSLNYLPKTQQLQMGFR + 2 Deamidated (NQ)
1534 379.8911 1136.6515 1136.6302 18.7 1 6 0.93 +1Score > 36 indicates identity
Score > 18 indicates homology		 LNHLIGSVER
3552 733.0221 2196.0445 2196.0442 0.12 1 6 0.48 +1Score > 39 indicates identity
Score > 15 indicates homology		 TATIDKNNMMQYIAPQDLK + 2 Deamidated (NQ)
3188 994.9768 1987.9390 1987.9350 2.05 1 6 0.93 +1Score > 39 indicates identity
Score > 18 indicates homology		 AGGFNDFATLAVIFEQCK + Deamidated (NQ)
1871 647.3367 1292.6588 1292.6435 11.9 0 6 0.88 +1Score > 41 indicates identity
Score > 18 indicates homology		 FVVNNMVNVLE + Oxidation (M)
2258 493.6084 1477.8034 1477.8268 -15.8 1 6 0.8 +1Score > 38 indicates identity
Score > 17 indicates homology		 WSLRFLIWVMK
3016 930.9962 1859.9778 1860.0145 -19.7 1 6 1 +1Score > 39 indicates identity
Score > 18 indicates homology		 ENIPVTVFLLNGFQLR + Deamidated (NQ)
3798 595.7914 2379.1365 2379.1568 -8.52 0 6 0.95 +1Score > 39 indicates identity
Score > 18 indicates homology		 NGPVGPTGPVGAAGPSGPNGPPGPAGSR + Deamidated (NQ)
750 405.7281 809.4416 809.4508 -11.3 1 6 0.56 +1Score > 38 indicates identity
Score > 16 indicates homology		 AIDAHKR
3556 733.3639 2197.0699 2197.0647 2.36 1 6 0.74 +1Score > 39 indicates identity
Score > 17 indicates homology		 GEVTVGMDVMIDINVIFQGK + Deamidated (NQ); 2 Oxidation (M)
3104 640.9825 1919.9257 1919.9445 -9.79 0 6 0.46 +1Score > 40 indicates identity
Score > 15 indicates homology		 LMSTTDLQQGQLVAMQR + Deamidated (NQ)
3516 727.0270 2178.0592 2178.0263 15.1 1 6 0.64 +1Score > 40 indicates identity
Score > 16 indicates homology		 ILGGEYQPDSGGVLVDGQAMR + Deamidated (NQ); Oxidation (M)
3891 822.7810 2465.3212 2465.3125 3.50 1 6 0.79 +1Score > 35 indicates identity
Score > 17 indicates homology		 IESAVADGPQSVILNQVTNGIAIR + Deamidated (NQ)
1941 442.8983 1325.6731 1325.6728 0.24 0 6 0.77 +1Score > 41 indicates identity
Score > 17 indicates homology		 IFAQAIHNASPR + 2 Deamidated (NQ)
1763 618.3079 1234.6012 1234.5863 12.1 1 6 0.6 +1Score > 41 indicates identity
Score > 16 indicates homology		 QGVDMTAQELK + Oxidation (M)
3081 477.5094 1906.0085 1905.9982 5.41 1 6 0.85 +1Score > 38 indicates identity
Score > 17 indicates homology		 LEALIPHNLGAMADIATR + Deamidated (NQ)
4770 932.4805 6520.3126 6520.1973 17.7 1 6 1 +1Score > 27 indicates identity
Score > 18 indicates homology		 FATFLNVMHLPGTGELTVFVAAVTAACFGFLWYNGYPATVFMGDTGALALGGAVGSTILMVR + 2 Deamidated (NQ); 3 Oxidation (M)
2638 826.4354 1650.8562 1650.8689 -7.65 1 6 0.81 +1Score > 40 indicates identity
Score > 17 indicates homology		 QQASQLAAVLPNPRR + 3 Deamidated (NQ)
3867 813.1082 2436.3028 2436.2604 17.4 1 6 0.34 +1Score > 36 indicates identity
Score > 13 indicates homology		 MIKNITGIAMSGGVDSTATAILQK + Deamidated (NQ); Oxidation (M)
2816 578.9664 1733.8774 1733.9022 -14.3 1 6 0.65 +1Score > 40 indicates identity
Score > 16 indicates homology		 LLSNLLAQAEAFMVGR + 2 Deamidated (NQ)
3819 797.4382 2389.2928 2389.3216 -12.1 1 6 0.62 +1Score > 35 indicates identity
Score > 16 indicates homology		 ALFLTSKQATLTQTLLIQNGAR + 2 Deamidated (NQ)
2605 546.3036 1635.8890 1635.8766 7.53 0 6 0.39 +1Score > 37 indicates identity
Score > 14 indicates homology		 GKPVTAMLQVQAVHR + 2 Deamidated (NQ)
3574 737.0535 2208.1387 2208.1096 13.2 1 6 0.99 +1Score > 38 indicates identity
Score > 18 indicates homology		 MTTQAPPSNLLPLNPEQLAR + 2 Deamidated (NQ); Oxidation (M)
3324 692.7158 2075.1256 2075.1402 -7.03 1 6 0.38 +1Score > 36 indicates identity
Score > 14 indicates homology		 ISIYDLKDVVQVVNDLLK + 2 Deamidated (NQ)
250 531.3271 530.3198 530.3176 4.14 0 5 0.78 +1Score > 46 indicates identity
Score > 17 indicates homology		 AITAR
978 906.5012 905.4939 905.5044 -11.6 0 5 0.92 +1Score > 41 indicates identity
Score > 18 indicates homology		 AYMLIPAK
3051 471.2515 1880.9769 1880.9884 -6.10 0 5 0.57 +1Score > 39 indicates identity
Score > 16 indicates homology		 IIDFQIAQVHTLPLGSE + Deamidated (NQ)
3196 666.0623 1995.1651 1995.1266 19.3 1 5 0.39 +1Score > 29 indicates identity
Score > 14 indicates homology		 VGRGPLAGPVISAAVIFTDR
2646 414.9636 1655.8253 1655.8114 8.38 0 5 0.98 +1Score > 40 indicates identity
Score > 18 indicates homology		 ANSSIIQAINQNEPR + 2 Deamidated (NQ)
3814 1194.0941 2386.1736 2386.1371 15.3 0 5 0.64 +1Score > 39 indicates identity
Score > 16 indicates homology		 LVTNIVMMGMGEPLYNFDAVR + Deamidated (NQ); Oxidation (M)
4236 962.4506 2884.3300 2884.3128 5.94 0 5 0.37 +1Score > 36 indicates identity
Score > 14 indicates homology		 NPAGTAVMRPMMPQAFFNAQMAAQQK + Deamidated (NQ); 3 Oxidation (M)
4285 986.5359 2956.5859 2956.5408 15.2 0 5 0.77 +1Score > 33 indicates identity
Score > 17 indicates homology		 YAAYGLVMPSLVLNYFGQGALLIQNPK + Deamidated (NQ); Oxidation (M)
3079 636.2833 1905.8281 1905.8488 -10.9 0 5 0.51 +1Score > 36 indicates identity
Score > 15 indicates homology		 TLQDMMNIIDYNQYK + Deamidated (NQ); Oxidation (M)
2327 505.2805 1512.8197 1512.7896 19.9 1 5 0.83 +1Score > 39 indicates identity
Score > 17 indicates homology		 QINSENNNINILK
3843 805.7709 2414.2909 2414.2805 4.29 1 5 0.88 +1Score > 36 indicates identity
Score > 17 indicates homology		 QQGGIPAVLYSGGKSLANIVVDAR + 2 Deamidated (NQ)
3322 1038.5338 2075.0530 2075.0535 -0.20 1 5 0.92 +1Score > 39 indicates identity
Score > 18 indicates homology		 ENQALASLQPFAIITSDTR + Deamidated (NQ)
3776 590.3229 2357.2625 2357.2460 6.98 1 5 0.53 +1Score > 36 indicates identity
Score > 15 indicates homology		 GLMVGQGINMAHLRGTLTAFVR + Oxidation (M)
4175 702.8946 2807.5493 2807.5605 -4.00 1 5 0.41 +1Score > 31 indicates identity
Score > 14 indicates homology		 LSNLQAMLPILEAVVQTSKPLVIISE + 2 Deamidated (NQ)
Page: Previous 1 …15 16 17 18 19 20 21 22 23 24 25 … 37 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/