MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | Rita2 sp |
| MS data file | : | PRT1270_T-BRSC_2_20250714115216.mgf |
| Database | : | SwissProt 57.15 (515,203 sequences; 181,334,896 residues) |
| Timestamp | : | 12 Aug 2025 at 23:39:15 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | GluC_Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,778 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 2785 |
862.4788 | 1722.9430 | 1722.9192 | 13.8 | 1 | 8 | 0.61 | 1Score > 37 indicates identity Score > 19 indicates homology |
LQSNTKIVLFSGWTK + 2 Deamidated (NQ) |
| 2224 |
366.4664 | 1461.8365 | 1461.8079 | 19.6 | 1 | 8 | 0.62 | 1Score > 35 indicates identity Score > 19 indicates homology |
TTEGLAGALFQLIK + Deamidated (NQ) |
| 2691 |
558.3119 | 1671.9139 | 1671.9235 | -5.78 | 1 | 8 | 0.26 | 1Score > 38 indicates identity Score > 15 indicates homology |
YVAYNAYKLIVLNK + Deamidated (NQ) |
| 3594 |
1112.0237 | 2222.0328 | 2222.0678 | -15.7 | 1 | 8 | 0.77 | 1Score > 38 indicates identity Score > 20 indicates homology |
QILPLFDQFTQDIAAECGR + Deamidated (NQ) |
| 2468 |
527.6370 | 1579.8892 | 1579.8835 | 3.61 | 1 | 8 | 0.5 | 1Score > 35 indicates identity Score > 18 indicates homology |
GLPVTIFPDPRVNR |
| 3088 |
638.3117 | 1911.9133 | 1911.9473 | -17.8 | 0 | 8 | 0.97 | 1Score > 40 indicates identity Score > 21 indicates homology |
HMDQLQQNVSIVTQQK + Oxidation (M) |
| 3395 |
706.0325 | 2115.0757 | 2115.1133 | -17.8 | 0 | 8 | 0.8 | 1Score > 39 indicates identity Score > 20 indicates homology |
TVTVLNTILLQNMGAALTPE + Deamidated (NQ); Oxidation (M) |
| 3901 |
826.4407 | 2476.3003 | 2476.2996 | 0.29 | 1 | 8 | 0.4 | 1Score > 36 indicates identity Score > 17 indicates homology |
VPTLDGHVKLTIPAGTQPNTMLR + 2 Deamidated (NQ); Oxidation (M) |
| 2293 |
500.6704 | 1498.9894 | 1498.9824 | 4.68 | 1 | 8 | 0.15 | 1Score > 13 indicates identity |
GLLPVLRPLPRLR |
| 2486 |
529.6292 | 1585.8658 | 1585.8940 | -17.8 | 1 | 8 | 0.54 | 1Score > 38 indicates identity Score > 18 indicates homology |
RLSGNLSIPNVFIR + Deamidated (NQ) |
| 2711 |
843.9465 | 1685.8784 | 1685.8736 | 2.86 | 1 | 8 | 0.89 | 1Score > 40 indicates identity Score > 20 indicates homology |
ATWAKNIQAAINQVR + 3 Deamidated (NQ) |
| 3189 |
994.9768 | 1987.9390 | 1987.9375 | 0.79 | 1 | 8 | 0.81 | 1Score > 39 indicates identity Score > 20 indicates homology |
SLVTSFSDFSDVTQGELR + Deamidated (NQ) |
| 2546 |
806.9557 | 1611.8968 | 1611.8944 | 1.51 | 1 | 8 | 0.47 | 1Score > 37 indicates identity Score > 17 indicates homology |
TKTIIDQAGATPGAIR |
| 3939 |
837.4714 | 2509.3924 | 2509.4011 | -3.49 | 1 | 8 | 0.31 | 1Score > 32 indicates identity Score > 16 indicates homology |
LAQLILSMPNLNLRGIMAVPSIK + 2 Deamidated (NQ); Oxidation (M) |
| 4388 |
778.9271 | 3111.6793 | 3111.6454 | 10.9 | 0 | 8 | 1 | 1Score > 32 indicates identity Score > 21 indicates homology |
IVSSLVNNIIMPFVGVLLGGLDFSDLSFK + 2 Deamidated (NQ); Oxidation (M) |
| 1376 |
354.5301 | 1060.5685 | 1060.5513 | 16.2 | 0 | 8 | 0.89 | 1Score > 41 indicates identity Score > 20 indicates homology |
SNLATSAQIR + Deamidated (NQ) |
| 1425 |
362.5464 | 1084.6174 | 1084.6240 | -6.13 | 1 | 8 | 0.63 | 1Score > 39 indicates identity Score > 19 indicates homology |
LGRLAQQGLK + 2 Deamidated (NQ) |
| 3336 |
520.5438 | 2078.1461 | 2078.1081 | 18.3 | 1 | 8 | 0.24 | 1Score > 34 indicates identity Score > 15 indicates homology |
QMLAGLLKSLGGTLNFLQR + 3 Deamidated (NQ); Oxidation (M) |
| 3377 |
703.0198 | 2106.0376 | 2106.0224 | 7.18 | 1 | 8 | 0.44 | 1Score > 39 indicates identity Score > 17 indicates homology |
MLGLDSMADAQELSIIGVVE + Oxidation (M) |
| 1962 |
668.8314 | 1335.6482 | 1335.6340 | 10.7 | 1 | 8 | 0.79 | 1Score > 41 indicates identity Score > 20 indicates homology |
MNELDSLVATAR + Deamidated (NQ); Oxidation (M) |
| 1343 |
522.2761 | 1042.5376 | 1042.5519 | -13.7 | 1 | 8 | 0.65 | 1Score > 41 indicates identity Score > 19 indicates homology |
ADGASTPRLR |
| 3725 |
578.0345 | 2308.1089 | 2308.0933 | 6.75 | 1 | 8 | 0.23 | 1Score > 39 indicates identity Score > 14 indicates homology |
FIILSDILGDEDHLGDMDFK + Oxidation (M) |
| 2960 |
913.4375 | 1824.8604 | 1824.8671 | -3.66 | 1 | 8 | 0.26 | 1Score > 40 indicates identity Score > 15 indicates homology |
VMAALCLATDLMDLKE + 2 Oxidation (M) |
| 3085 |
636.7192 | 1907.1358 | 1907.0979 | 19.9 | 1 | 8 | 1 | 1Score > 27 indicates identity Score > 21 indicates homology |
LPVLGAVIKNNILDVVTE + Deamidated (NQ) |
| 4030 |
659.8149 | 2635.2305 | 2635.2186 | 4.50 | 1 | 8 | 0.25 | 1Score > 37 indicates identity Score > 15 indicates homology |
GQTVFMGDFPLMTDKGTFIINGTE + Deamidated (NQ); Oxidation (M) |
| 2311 |
753.9341 | 1505.8536 | 1505.8314 | 14.8 | 1 | 8 | 0.53 | 1Score > 35 indicates identity Score > 18 indicates homology |
LLEPSLGKSGVNHR |
| 2699 |
837.4801 | 1672.9456 | 1672.9359 | 5.81 | 1 | 8 | 0.54 | 1Score > 35 indicates identity Score > 18 indicates homology |
LVQSQLLKSVVSGSAR + 2 Deamidated (NQ) |
| 465 |
342.2269 | 682.4392 | 682.4378 | 2.18 | 0 | 8 | 0.84 | 1Score > 34 indicates identity Score > 20 indicates homology |
IAVVPGK |
| 1146 |
481.7762 | 961.5378 | 961.5379 | -0.025 | 1 | 8 | 0.85 | 1Score > 39 indicates identity Score > 20 indicates homology |
VGAMTSLRK |
| 3019 |
622.3085 | 1863.9037 | 1863.9400 | -19.5 | 1 | 8 | 0.68 | 1Score > 40 indicates identity Score > 19 indicates homology |
SVKGQMLQDPFLNTLR + 2 Deamidated (NQ); Oxidation (M) |
| 3020 |
622.3098 | 1863.9076 | 1863.8851 | 12.1 | 1 | 8 | 0.64 | 1Score > 40 indicates identity Score > 19 indicates homology |
AFVSIEDNVVAGGAGSGVSE |
| 3122 |
648.0318 | 1941.0736 | 1941.0611 | 6.43 | 0 | 8 | 0.65 | 1Score > 35 indicates identity Score > 19 indicates homology |
LIIDWHNLAYSILQLK + 2 Deamidated (NQ) |
| 3481 |
719.7215 | 2156.1427 | 2156.1338 | 4.11 | 1 | 8 | 0.46 | 1Score > 37 indicates identity Score > 17 indicates homology |
VSNRDAAQLVASDLGFALGPR |
| 2025 |
456.2312 | 1365.6718 | 1365.6637 | 5.94 | 1 | 8 | 0.97 | 1Score > 41 indicates identity Score > 21 indicates homology |
RSHDALVASNPAE |
| 3007 |
620.3216 | 1857.9430 | 1857.9486 | -3.01 | 1 | 8 | 0.57 | 1Score > 40 indicates identity Score > 18 indicates homology |
YRYNHLDLGDIGGIPR |
| 2305 |
752.4182 | 1502.8218 | 1502.8456 | -15.8 | 1 | 8 | 0.99 | 1Score > 38 indicates identity Score > 21 indicates homology |
IANVNKALDFIASK |
| 3065 |
630.3453 | 1888.0141 | 1887.9942 | 10.5 | 1 | 8 | 0.49 | 1Score > 38 indicates identity Score > 18 indicates homology |
FGRLVQLQTLILQDNE + 2 Deamidated (NQ) |
| 3447 |
714.7215 | 2141.1427 | 2141.1820 | -18.3 | 1 | 8 | 0.82 | 1Score > 37 indicates identity Score > 20 indicates homology |
RGADTIVVVPLLFAAGMHFK |
| 3755 |
585.0388 | 2336.1261 | 2336.1179 | 3.51 | 1 | 8 | 0.54 | 1Score > 39 indicates identity Score > 18 indicates homology |
NASKGPHSPQVPSQVQSPMTSR + Deamidated (NQ); Oxidation (M) |
| 3221 |
671.0385 | 2010.0937 | 2010.0898 | 1.91 | 1 | 8 | 0.38 | 1Score > 36 indicates identity Score > 16 indicates homology |
LASIKGLHDIGTFVAPDTR |
| 1812 |
633.8768 | 1265.7390 | 1265.7496 | -8.33 | 1 | 8 | 0.19 | 1Score > 34 indicates identity Score > 13 indicates homology |
VPLELVPIIHH |
| 2147 |
474.8929 | 1421.6569 | 1421.6834 | -18.6 | 0 | 8 | 0.88 | 1Score > 41 indicates identity Score > 20 indicates homology |
MVDGHAQTIAHAR + Oxidation (M) |
| 3185 |
663.3480 | 1987.0222 | 1987.0098 | 6.24 | 1 | 8 | 0.74 | 1Score > 39 indicates identity Score > 19 indicates homology |
LAMLSTHYRQPINWTR + Deamidated (NQ) |
| 1699 |
607.3349 | 1212.6552 | 1212.6615 | -5.15 | 0 | 8 | 0.29 | 1Score > 40 indicates identity Score > 15 indicates homology |
VFSNDIHLLR |
| 2934 |
603.3113 | 1806.9121 | 1806.9251 | -7.22 | 1 | 8 | 0.37 | 1Score > 40 indicates identity Score > 16 indicates homology |
SIGVSNFTEDLLATVIE |
| 3515 |
1090.0338 | 2178.0530 | 2178.0853 | -14.8 | 0 | 8 | 0.83 | 1Score > 39 indicates identity Score > 20 indicates homology |
LMLASMFHSLFAIGSQLSPE |
| 2225 |
732.3940 | 1462.7734 | 1462.7901 | -11.4 | 1 | 8 | 0.91 | 1Score > 40 indicates identity Score > 20 indicates homology |
KTHMISMHPIIR |
| 3882 |
816.7599 | 2447.2579 | 2447.2471 | 4.39 | 1 | 8 | 0.36 | 1Score > 38 indicates identity Score > 16 indicates homology |
IKWGQYVTQNQILGINDVLIE + 4 Deamidated (NQ) |
| 533 |
354.7071 | 707.3996 | 707.3966 | 4.32 | 1 | 8 | 0.85 | 1Score > 37 indicates identity Score > 20 indicates homology |
KYAGAAK |
| 1541 |
380.5693 | 1138.6861 | 1138.6822 | 3.38 | 0 | 8 | 0.7 | 1Score > 33 indicates identity Score > 19 indicates homology |
LRPLIADSVR |
| 3537 |
730.3839 | 2188.1299 | 2188.1636 | -15.4 | 0 | 8 | 0.78 | 1Score > 38 indicates identity Score > 19 indicates homology |
MFTIDIILQMSPIPVSVQR + Deamidated (NQ) |
| 3986 |
856.4779 | 2566.4119 | 2566.3837 | 11.0 | 1 | 8 | 0.29 | 1Score > 33 indicates identity Score > 15 indicates homology |
MNKPFLILLIALIAFSGCNMRK + Deamidated (NQ); Oxidation (M) |
| 3034 |
623.6557 | 1867.9453 | 1867.9136 | 16.9 | 1 | 8 | 0.72 | 1Score > 39 indicates identity Score > 19 indicates homology |
VDIRQHGSGNAGATNTLR + 2 Deamidated (NQ) |
| 3758 |
780.4009 | 2338.1809 | 2338.1474 | 14.3 | 0 | 8 | 0.78 | 1Score > 38 indicates identity Score > 19 indicates homology |
SVHANILNDISPQIVSDMINR + 3 Deamidated (NQ) |
| 4539 |
840.9642 | 3359.8277 | 3359.8931 | -19.5 | 1 | 8 | 0.3 | 1Score > 31 indicates identity Score > 15 indicates homology |
YDQLLSFAWKVALPLSLLNLMLTGIVVVAR + Deamidated (NQ); Oxidation (M) |
| 2780 |
860.4635 | 1718.9124 | 1718.9138 | -0.76 | 1 | 8 | 0.89 | 1Score > 39 indicates identity Score > 20 indicates homology |
GMGNLLDFQLRLAQK + Oxidation (M) |
| 2981 |
461.4889 | 1841.9265 | 1841.9537 | -14.7 | 1 | 8 | 0.8 | 1Score > 40 indicates identity Score > 20 indicates homology |
QVQFAHAATQHYKSVK |
| 3347 |
696.6768 | 2087.0086 | 2086.9816 | 12.9 | 1 | 8 | 0.99 | 1Score > 39 indicates identity Score > 20 indicates homology |
YSLLTNSWSTAKSMNMPR + Deamidated (NQ) |
| 1523 |
378.5259 | 1132.5559 | 1132.5360 | 17.5 | 1 | 8 | 0.88 | 1Score > 42 indicates identity Score > 20 indicates homology |
KVLGNDSDQR + 2 Deamidated (NQ) |
| 1535 |
379.8913 | 1136.6521 | 1136.6441 | 7.01 | 0 | 8 | 0.91 | 1Score > 36 indicates identity Score > 20 indicates homology |
SIASTIASIFK |
| 3561 |
733.3976 | 2197.1710 | 2197.1670 | 1.79 | 1 | 8 | 0.18 | 1Score > 37 indicates identity Score > 13 indicates homology |
FAYASTFKALLAGAVLQSLPE + Deamidated (NQ) |
| 1650 |
594.8245 | 1187.6344 | 1187.6146 | 16.7 | 1 | 8 | 0.79 | 1Score > 41 indicates identity Score > 19 indicates homology |
RVAQQLLSGSE + Deamidated (NQ) |
| 514 |
351.7325 | 701.4504 | 701.4476 | 4.06 | 0 | 8 | 0.46 | 1Score > 35 indicates identity Score > 17 indicates homology |
VPIFVK |
| 554 |
361.2171 | 720.4196 | 720.4204 | -1.04 | 1 | 8 | 0.98 | 1Score > 38 indicates identity Score > 20 indicates homology |
MTKVVK + Oxidation (M) |
| 3461 |
716.4178 | 2146.2316 | 2146.1898 | 19.5 | 1 | 8 | 1 | 1Score > 30 indicates identity Score > 20 indicates homology |
ILGHLDLLNAKAQYAHQLK + Deamidated (NQ) |
| 2595 |
816.4543 | 1630.8940 | 1630.8719 | 13.6 | 0 | 8 | 1 | 1Score > 37 indicates identity Score > 20 indicates homology |
LTLHGLQQYFVALE |
| 2708 |
843.4814 | 1684.9482 | 1684.9247 | 14.0 | 1 | 8 | 0.82 | 1Score > 36 indicates identity Score > 20 indicates homology |
QAQILLESVNIITNK + 2 Deamidated (NQ) |
| 3419 |
1064.5632 | 2127.1118 | 2127.0823 | 13.9 | 1 | 8 | 0.57 | 1Score > 38 indicates identity Score > 18 indicates homology |
AGRYQFMVYAGPLSEPTLK |
| 2031 |
456.5703 | 1366.6891 | 1366.7133 | -17.7 | 0 | 8 | 0.72 | 1Score > 40 indicates identity Score > 19 indicates homology |
ATFTTQVLNPFK + Deamidated (NQ) |
| 2110 |
701.8998 | 1401.7850 | 1401.8014 | -11.6 | 1 | 8 | 0.84 | 1Score > 37 indicates identity Score > 20 indicates homology |
TMLSRLVISPTGK |
| 2599 |
408.7471 | 1630.9593 | 1630.9406 | 11.4 | 1 | 8 | 0.86 | 1Score > 31 indicates identity Score > 20 indicates homology |
LDTVLFQKQLGTLR |
| 2664 |
556.6258 | 1666.8556 | 1666.8301 | 15.3 | 1 | 8 | 0.61 | 1Score > 40 indicates identity Score > 18 indicates homology |
ITATELAGLADTISYE |
| 3135 |
653.0301 | 1956.0685 | 1956.0424 | 13.3 | 1 | 8 | 0.95 | 1Score > 36 indicates identity Score > 20 indicates homology |
MLTLAAELGADVPVCLVGK |
| 1890 |
435.2614 | 1302.7624 | 1302.7395 | 17.6 | 0 | 8 | 0.55 | 1Score > 34 indicates identity Score > 18 indicates homology |
IVLVVNSGSSSIK + Deamidated (NQ) |
| 2283 |
749.9359 | 1497.8572 | 1497.8402 | 11.4 | 0 | 8 | 0.89 | 1Score > 35 indicates identity Score > 20 indicates homology |
LSLDGALDQAAALLK |
| 225 |
506.2674 | 505.2601 | 505.2570 | 6.15 | 0 | 8 | 1 | 1Score > 43 indicates identity Score > 20 indicates homology |
MGGLL + Oxidation (M) |
| 1374 |
530.7458 | 1059.4770 | 1059.4945 | -16.5 | 0 | 8 | 0.77 | 1Score > 39 indicates identity Score > 19 indicates homology |
QATDNGIQGR + Deamidated (NQ) |
| 2102 |
467.6089 | 1399.8049 | 1399.7935 | 8.09 | 1 | 8 | 0.96 | 1Score > 36 indicates identity Score > 20 indicates homology |
LAGNPLLRYDIR |
| 3789 |
789.4026 | 2365.1860 | 2365.1922 | -2.65 | 1 | 8 | 0.63 | 1Score > 38 indicates identity Score > 18 indicates homology |
NNTPYLGICLGMQVAVIEFAR |
| 472 |
343.6675 | 685.3204 | 685.3143 | 8.93 | 0 | 8 | 0.58 | 1Score > 37 indicates identity Score > 18 indicates homology |
NPNGQR + Deamidated (NQ) |
| 2450 |
524.9781 | 1571.9125 | 1571.9148 | -1.46 | 1 | 8 | 0.21 | 1Score > 33 indicates identity Score > 14 indicates homology |
VVRVQPPAPPVAVSR + Deamidated (NQ) |
| 2897 |
895.9016 | 1789.7886 | 1789.7936 | -2.77 | 0 | 8 | 0.42 | 1Score > 38 indicates identity Score > 17 indicates homology |
ASQSVMQFMQNMLIK + 3 Deamidated (NQ); 2 Oxidation (M) |
| 3682 |
1147.5847 | 2293.1548 | 2293.1240 | 13.5 | 1 | 8 | 0.89 | 1Score > 39 indicates identity Score > 20 indicates homology |
FWLGNDHIHALTAQGTNELR + Deamidated (NQ) |
| 3223 |
671.3330 | 2010.9772 | 2010.9979 | -10.3 | 1 | 8 | 0.72 | 1Score > 40 indicates identity Score > 19 indicates homology |
MAIAQNVGAMSSYLNRLR + Deamidated (NQ); Oxidation (M) |
| 1613 |
587.2880 | 1172.5614 | 1172.5713 | -8.43 | 0 | 8 | 0.84 | 1Score > 40 indicates identity Score > 20 indicates homology |
LQLLQQDWE + Deamidated (NQ) |
| 2565 |
808.4554 | 1614.8962 | 1614.8916 | 2.88 | 1 | 8 | 0.85 | 1Score > 37 indicates identity Score > 20 indicates homology |
VGGMGDVVGALPKFLR |
| 4514 |
662.3714 | 3306.8206 | 3306.8380 | -5.25 | 1 | 8 | 0.83 | 1Score > 30 indicates identity Score > 20 indicates homology |
NFLLLLLAAYALGSTPFAIVSSRLFGLADPR + Deamidated (NQ) |
| 2447 |
524.2921 | 1569.8545 | 1569.8838 | -18.7 | 1 | 8 | 0.96 | 1Score > 39 indicates identity Score > 20 indicates homology |
AIIASGVQVQKSDVR |
| 2704 |
562.2942 | 1683.8608 | 1683.8356 | 15.0 | 1 | 8 | 0.81 | 1Score > 40 indicates identity Score > 19 indicates homology |
NGQVFITNLATFTEK + 2 Deamidated (NQ) |
| 2623 |
548.9676 | 1643.8810 | 1643.8743 | 4.04 | 1 | 8 | 0.62 | 1Score > 39 indicates identity Score > 18 indicates homology |
QLGPQAQYAGRSVLR + Deamidated (NQ) |
| 2731 |
566.9874 | 1697.9404 | 1697.9440 | -2.11 | 0 | 8 | 0.62 | 1Score > 36 indicates identity Score > 18 indicates homology |
VPRPLFPLPMFNVR + Oxidation (M) |
| 3246 |
1012.5308 | 2023.0470 | 2023.0408 | 3.07 | 0 | 8 | 0.46 | 1Score > 39 indicates identity Score > 17 indicates homology |
VTALADGVLSTGQMVTYAAR |
| 3655 |
1134.0789 | 2266.1432 | 2266.1805 | -16.4 | 1 | 8 | 0.28 | 1Score > 39 indicates identity Score > 15 indicates homology |
NPIQDIKITSDTNVPVNAGIR + 2 Deamidated (NQ) |
| 3677 |
761.4078 | 2281.2016 | 2281.1703 | 13.7 | 1 | 8 | 0.22 | 1Score > 37 indicates identity Score > 14 indicates homology |
FIVGNTAPVNGDSYKSGTVTVR |
| 3911 |
830.4592 | 2488.3558 | 2488.3397 | 6.44 | 1 | 8 | 0.26 | 1Score > 34 indicates identity Score > 14 indicates homology |
VDSLIKSLIPNNIHNLQVSNNR + Deamidated (NQ) |
| 526 |
354.1787 | 706.3428 | 706.3432 | -0.50 | 0 | 8 | 0.82 | 1Score > 41 indicates identity Score > 19 indicates homology |
AGMVSSR |
| 1353 |
1047.5441 | 1046.5368 | 1046.5430 | -5.90 | 1 | 8 | 0.79 | 1Score > 42 indicates identity Score > 19 indicates homology |
QPQISKMAK + Deamidated (NQ); Oxidation (M) |
| 3162 |
990.5215 | 1979.0284 | 1979.0372 | -4.45 | 1 | 8 | 0.92 | 1Score > 39 indicates identity Score > 20 indicates homology |
FLKCLGPNLIFDMGLNK |
| 1228 |
498.7806 | 995.5466 | 995.5400 | 6.68 | 0 | 8 | 0.69 | 1Score > 38 indicates identity Score > 19 indicates homology |
APPTTAVPSR |
| 1420 |
542.7633 | 1083.5120 | 1083.5196 | -6.99 | 1 | 8 | 0.85 | 1Score > 40 indicates identity Score > 19 indicates homology |
NKSPPQNAVE + Deamidated (NQ) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/