MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita2 sp
MS data file : PRT1270_T-BRSC_2_20250714115216.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 23:39:15 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,778

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 179)


Page: 1 2 3 4 5 6  18 Next 

+1

Accession Score Description
Family member distances as a dendrogram 1 EFTU2_PSEPK 1121 Elongation factor Tu-B OS=Pseudomonas putida (strain KT2440) GN=tufB PE=3 SV=1
6 EFTU_CYAP7 40 Elongation factor Tu OS=Cyanothece sp. (strain PCC 7424) GN=tuf PE=3 SV=1
5 EFTU_ANATD 50 Elongation factor Tu OS=Anaerocellum thermophilum (strain DSM 6725 / Z-1320) GN=tuf PE=3 SV=1
3 EFTU_PSEFS 701 Elongation factor Tu OS=Pseudomonas fluorescens (strain SBW25) GN=tuf PE=3 SV=1
2 EFTU1_PSEPK 1002 Elongation factor Tu-A OS=Pseudomonas putida (strain KT2440) GN=tufA PE=3 SV=1
4 EFTU_CARRP 145 Elongation factor Tu OS=Carsonella ruddii (strain PV) GN=tuf PE=3 SV=1

-2

Accession Score Description
1 ATPB_PSEPG 972 ATP synthase subunit beta OS=Pseudomonas putida (strain GB-1) GN=atpD PE=3 SV=1
Score Mass Matches Sequences emPAI
2.1 ATPB_PSEPG 972 49415 36 (26) 14 (11) 0.89
ATP synthase subunit beta OS=Pseudomonas putida (strain GB-1) GN=atpD PE=3 SV=1
2 samesets of ATPB_PSEPG
ATPB_PSEPK 972 49385 36 (26) 14 (11) 0.89
ATP synthase subunit beta OS=Pseudomonas putida (strain KT2440) GN=atpD PE=3 SV=1
ATPB_PSEP1 972 49385 36 (26) 14 (11) 0.89
ATP synthase subunit beta OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=atpD PE=3 SV=1

-36 peptide matches (19 non-duplicate, 17 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
315   305.1850 608.3554 608.3533 3.45 0 14 0.48 +1Score > 31 indicates identity
Score > 24 indicates homology
K.YVSLK.D
711   395.7015 789.3884 789.3868 2.04 0 22 1.2 +2Score > 43 indicates identity
Score > 36 indicates homology
K.DSNVLDK.V
1141 +2 481.2800 960.5454 960.5393 6.41 0 68 7.7e-005 +1Score > 39 indicates identity U K.VGLFGGAGVGK.T
1145   962.5447 961.5374 961.5345 3.03 0 35 0.16 +2Score > 39 indicates identity U R.GVQYVLQR.Y
1147 +2 481.7768 961.5390 961.5345 4.71 0 34 0.083 +1Score > 39 indicates identity
Score > 35 indicates homology
U R.GVQYVLQR.Y
1524   567.3204 1132.6262 1132.6162 8.89 1 25 0.041 +1Score > 39 indicates identity
Score > 24 indicates homology
U R.VALTGLTMAEK.F
1587   581.3287 1160.6428 1160.6264 14.2 0 26 0.019 +1Score > 39 indicates identity
Score > 22 indicates homology
U K.VIDLVCPFAK.G
1684 +2 602.8378 1203.6610 1203.6499 9.23 0 37 0.013 +1Score > 39 indicates identity
Score > 30 indicates homology
U R.DVVPSVYNALK.V
2201 +1 484.2732 1449.7978 1449.7827 10.4 1 97 5.8e-009 +1Score > 38 indicates identity
Score > 27 indicates homology
U R.YTLAGTEVSALLGR.M
2203 +2 725.9076 1449.8006 1449.7827 12.4 1 99 1.7e-009 +1Score > 37 indicates identity
Score > 23 indicates homology
U R.YTLAGTEVSALLGR.M
2507 -2 799.4525 1596.8904 1596.8723 11.4 0 94 1.2e-007 +1Score > 37 indicates identity U R.GLDVVDTGAAISVPVGK.A
2505   799.4503 1596.8860 1596.8723 8.60 0 (75) 9.3e-006 +1Score > 37 indicates identity U R.GLDVVDTGAAISVPVGK.A
2506   799.4523 1596.8900 1596.8723 11.1 0 (93) 1.4e-007 +1Score > 37 indicates identity U R.GLDVVDTGAAISVPVGK.A
2508   533.3050 1596.8932 1596.8723 13.1 0 17 1.3 +2Score > 37 indicates identity
Score > 30 indicates homology
U R.GLDVVDTGAAISVPVGK.A
2678 +1 557.0026 1667.9860 1667.9610 14.9 1 75 2.1e-006 +1Score > 30 indicates identity U R.IVQIIGAVIDVEFPR.D
2679 +3 835.0004 1667.9862 1667.9610 15.1 1 88 9e-008 +1Score > 30 indicates identity U R.IVQIIGAVIDVEFPR.D
2764   571.3336 1710.9790 1710.9556 13.7 1 4 13 +9Score > 34 indicates identity
Score > 27 indicates homology
U K.YVSLKDTIAGFSGILK.G
3137   979.5210 1957.0274 1956.9986 14.8 1 82 2.2e-006 +1Score > 38 indicates identity U R.FLSQPFFVAEVFTGSPGK.Y
3138   653.3513 1957.0321 1956.9986 17.1 1 61 1.1e-005 +1Score > 38 indicates identity
Score > 24 indicates homology
U R.FLSQPFFVAEVFTGSPGK.Y
3865 +1 813.0849 2436.2329 2436.1921 16.7 1 76 2e-007 +1Score > 38 indicates identity
Score > 22 indicates homology
U R.GIHQPAPSFADQAGGNDLLETGIK.V + Deamidated (NQ)
4631 +1 961.9999 3843.9705 3843.9055 16.9 1 33 0.0011 +1Score > 33 indicates identity
Score > 16 indicates homology
U K.EGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSR.D + Deamidated (NQ)

+30 subsets and intersections (604 subset proteins in total)


+3

Accession Score Description
Family member distances as a dendrogram 1 ATPA_PSEPK 749 ATP synthase subunit alpha OS=Pseudomonas putida (strain KT2440) GN=atpA PE=3 SV=1
2 ATPA_RICAH 179 ATP synthase subunit alpha OS=Rickettsia akari (strain Hartford) GN=atpA PE=3 SV=1
3 ATPA_VEREI 174 ATP synthase subunit alpha OS=Verminephrobacter eiseniae (strain EF01-2) GN=atpA PE=3 SV=1

+4

Accession Score Description
Family member distances as a dendrogram 1 CH60_PSEPK 584 60 kDa chaperonin OS=Pseudomonas putida (strain KT2440) GN=groL PE=3 SV=1
3 CH602_SORC5 80 60 kDa chaperonin 2 OS=Sorangium cellulosum (strain So ce56) GN=groL2 PE=3 SV=1
2 CH601_ECOK1 123 60 kDa chaperonin 1 OS=Escherichia coli O1:K1 / APEC GN=groL1 PE=3 SV=1

+5

Accession Score Description
1 DLDH2_PSEPU 541 Dihydrolipoamide dehydrogenase OS=Pseudomonas putida GN=lpdG PE=1 SV=4

+6

Accession Score Description
1 RL1_PSEE4 419 50S ribosomal protein L1 OS=Pseudomonas entomophila (strain L48) GN=rplA PE=3 SV=1

+7

Accession Score Description
1 EFG1_PSEPK 337 Elongation factor G 1 OS=Pseudomonas putida (strain KT2440) GN=fusA PE=3 SV=1

+8

Accession Score Description
1 RS5_PSEE4 331 30S ribosomal protein S5 OS=Pseudomonas entomophila (strain L48) GN=rpsE PE=3 SV=1

+9

Accession Score Description
Family member distances as a dendrogram 1 RL4_PSE14 327 50S ribosomal protein L4 OS=Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) GN=rplD PE=3 SV=1
2 RL4_PSEE4 318 50S ribosomal protein L4 OS=Pseudomonas entomophila (strain L48) GN=rplD PE=3 SV=1

+10

Accession Score Description
1 RL18_PSEP1 310 50S ribosomal protein L18 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplR PE=3 SV=1
Page: 1 2 3 4 5 6  18 Next 

Not what you expected? Try the select summary.