MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | Rita2 sp |
| MS data file | : | PRT1270_T-BRSC_2_20250714115216.mgf |
| Database | : | SwissProt 57.15 (515,203 sequences; 181,334,896 residues) |
| Timestamp | : | 12 Aug 2025 at 23:39:15 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | GluC_Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,778 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
1| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | EFTU2_PSEPK | 1121 | Elongation factor Tu-B OS=Pseudomonas putida (strain KT2440) GN=tufB PE=3 SV=1 | |
| 6 | EFTU_CYAP7 | 40 | Elongation factor Tu OS=Cyanothece sp. (strain PCC 7424) GN=tuf PE=3 SV=1 | |
| 5 | EFTU_ANATD | 50 | Elongation factor Tu OS=Anaerocellum thermophilum (strain DSM 6725 / Z-1320) GN=tuf PE=3 SV=1 | |
| 3 | EFTU_PSEFS | 701 | Elongation factor Tu OS=Pseudomonas fluorescens (strain SBW25) GN=tuf PE=3 SV=1 | |
| 2 | EFTU1_PSEPK | 1002 | Elongation factor Tu-A OS=Pseudomonas putida (strain KT2440) GN=tufA PE=3 SV=1 | |
| 4 | EFTU_CARRP | 145 | Elongation factor Tu OS=Carsonella ruddii (strain PV) GN=tuf PE=3 SV=1 | |
2| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | ATPB_PSEPG | 972 | ATP synthase subunit beta OS=Pseudomonas putida (strain GB-1) GN=atpD PE=3 SV=1 |
| Score | Mass | Matches | Sequences | emPAI | |||
|---|---|---|---|---|---|---|---|
| 2.1 | ATPB_PSEPG |
972 | 49415 | 36 (26) | 14 (11) | 0.89 | |
| ATP synthase subunit beta OS=Pseudomonas putida (strain GB-1) GN=atpD PE=3 SV=1 | |||||||
| 2 samesets of ATPB_PSEPG | |||||||
| ATPB_PSEPK |
972 | 49385 | 36 (26) | 14 (11) | 0.89 | ||
| ATP synthase subunit beta OS=Pseudomonas putida (strain KT2440) GN=atpD PE=3 SV=1 | |||||||
| ATPB_PSEP1 |
972 | 49385 | 36 (26) | 14 (11) | 0.89 | ||
| ATP synthase subunit beta OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=atpD PE=3 SV=1 | |||||||
36 peptide matches (19 non-duplicate, 17 duplicate)| Query | Dupes | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | U | Peptide |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Query | Dupes | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | U | Peptide |
| 315 |
305.1850 | 608.3554 | 608.3533 | 3.45 | 0 | 14 | 0.48 | 1Score > 31 indicates identity Score > 24 indicates homology |
K.YVSLK.D | ||
| 711 |
395.7015 | 789.3884 | 789.3868 | 2.04 | 0 | 22 | 1.2 | 2Score > 43 indicates identity Score > 36 indicates homology |
K.DSNVLDK.V | ||
| 1141 |
2 |
481.2800 | 960.5454 | 960.5393 | 6.41 | 0 | 68 | 7.7e-005 | 1Score > 39 indicates identity |
U | K.VGLFGGAGVGK.T |
| 1142 |
481.2801 | 960.5456 | 960.5393 | 6.62 | 0 | (63) | 0.00024 | 1Score > 39 indicates identity |
U | K.VGLFGGAGVGK.T | |
| 1143 |
481.2810 | 960.5474 | 960.5393 | 8.49 | 0 | (42) | 0.026 | 1Score > 39 indicates identity |
U | K.VGLFGGAGVGK.T | |
| 1145 |
962.5447 | 961.5374 | 961.5345 | 3.03 | 0 | 35 | 0.16 | 2Score > 39 indicates identity |
U | R.GVQYVLQR.Y | |
| 1147 |
2 |
481.7768 | 961.5390 | 961.5345 | 4.71 | 0 | 34 | 0.083 | 1Score > 39 indicates identity Score > 35 indicates homology |
U | R.GVQYVLQR.Y |
| 1524 |
567.3204 | 1132.6262 | 1132.6162 | 8.89 | 1 | 25 | 0.041 | 1Score > 39 indicates identity Score > 24 indicates homology |
U | R.VALTGLTMAEK.F | |
| 1587 |
581.3287 | 1160.6428 | 1160.6264 | 14.2 | 0 | 26 | 0.019 | 1Score > 39 indicates identity Score > 22 indicates homology |
U | K.VIDLVCPFAK.G | |
| 1684 |
2 |
602.8378 | 1203.6610 | 1203.6499 | 9.23 | 0 | 37 | 0.013 | 1Score > 39 indicates identity Score > 30 indicates homology |
U | R.DVVPSVYNALK.V |
| 2201 |
1 |
484.2732 | 1449.7978 | 1449.7827 | 10.4 | 1 | 97 | 5.8e-009 | 1Score > 38 indicates identity Score > 27 indicates homology |
U | R.YTLAGTEVSALLGR.M |
| 2203 |
2 |
725.9076 | 1449.8006 | 1449.7827 | 12.4 | 1 | 99 | 1.7e-009 | 1Score > 37 indicates identity Score > 23 indicates homology |
U | R.YTLAGTEVSALLGR.M |
| 2507 |
2 |
799.4525 | 1596.8904 | 1596.8723 | 11.4 | 0 | 94 | 1.2e-007 | 1Score > 37 indicates identity |
U | R.GLDVVDTGAAISVPVGK.A |
| 2508 |
533.3050 | 1596.8932 | 1596.8723 | 13.1 | 0 | 17 | 1.3 | 2Score > 37 indicates identity Score > 30 indicates homology |
U | R.GLDVVDTGAAISVPVGK.A | |
| 2678 |
1 |
557.0026 | 1667.9860 | 1667.9610 | 14.9 | 1 | 75 | 2.1e-006 | 1Score > 30 indicates identity |
U | R.IVQIIGAVIDVEFPR.D |
| 2679 |
3 |
835.0004 | 1667.9862 | 1667.9610 | 15.1 | 1 | 88 | 9e-008 | 1Score > 30 indicates identity |
U | R.IVQIIGAVIDVEFPR.D |
| 2764 |
571.3336 | 1710.9790 | 1710.9556 | 13.7 | 1 | 4 | 13 | 9Score > 34 indicates identity Score > 27 indicates homology |
U | K.YVSLKDTIAGFSGILK.G | |
| 3137 |
979.5210 | 1957.0274 | 1956.9986 | 14.8 | 1 | 82 | 2.2e-006 | 1Score > 38 indicates identity |
U | R.FLSQPFFVAEVFTGSPGK.Y | |
| 3138 |
653.3513 | 1957.0321 | 1956.9986 | 17.1 | 1 | 61 | 1.1e-005 | 1Score > 38 indicates identity Score > 24 indicates homology |
U | R.FLSQPFFVAEVFTGSPGK.Y | |
| 3865 |
1 |
813.0849 | 2436.2329 | 2436.1921 | 16.7 | 1 | 76 | 2e-007 | 1Score > 38 indicates identity Score > 22 indicates homology |
U | R.GIHQPAPSFADQAGGNDLLETGIK.V + Deamidated (NQ) |
| 4631 |
1 |
961.9999 | 3843.9705 | 3843.9055 | 16.9 | 1 | 33 | 0.0011 | 1Score > 33 indicates identity Score > 16 indicates homology |
U | K.EGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSR.D + Deamidated (NQ) |
30 subsets and intersections (604 subset proteins in total)3| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | ATPA_PSEPK | 749 | ATP synthase subunit alpha OS=Pseudomonas putida (strain KT2440) GN=atpA PE=3 SV=1 | |
| 2 | ATPA_RICAH | 179 | ATP synthase subunit alpha OS=Rickettsia akari (strain Hartford) GN=atpA PE=3 SV=1 | |
| 3 | ATPA_VEREI | 174 | ATP synthase subunit alpha OS=Verminephrobacter eiseniae (strain EF01-2) GN=atpA PE=3 SV=1 | |
4| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | CH60_PSEPK | 584 | 60 kDa chaperonin OS=Pseudomonas putida (strain KT2440) GN=groL PE=3 SV=1 | |
| 3 | CH602_SORC5 | 80 | 60 kDa chaperonin 2 OS=Sorangium cellulosum (strain So ce56) GN=groL2 PE=3 SV=1 | |
| 2 | CH601_ECOK1 | 123 | 60 kDa chaperonin 1 OS=Escherichia coli O1:K1 / APEC GN=groL1 PE=3 SV=1 | |
5| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | DLDH2_PSEPU | 541 | Dihydrolipoamide dehydrogenase OS=Pseudomonas putida GN=lpdG PE=1 SV=4 |
6| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | RL1_PSEE4 | 419 | 50S ribosomal protein L1 OS=Pseudomonas entomophila (strain L48) GN=rplA PE=3 SV=1 |
7| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | EFG1_PSEPK | 337 | Elongation factor G 1 OS=Pseudomonas putida (strain KT2440) GN=fusA PE=3 SV=1 |
8| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | RS5_PSEE4 | 331 | 30S ribosomal protein S5 OS=Pseudomonas entomophila (strain L48) GN=rpsE PE=3 SV=1 |
9| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | RL4_PSE14 | 327 | 50S ribosomal protein L4 OS=Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) GN=rplD PE=3 SV=1 | |
| 2 | RL4_PSEE4 | 318 | 50S ribosomal protein L4 OS=Pseudomonas entomophila (strain L48) GN=rplD PE=3 SV=1 | |
10| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | RL18_PSEP1 | 310 | 50S ribosomal protein L18 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplR PE=3 SV=1 |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/