MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita1 sp
MS data file : PRT1270_T-BRSC_1_20250714114344.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 22:50:29 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,938

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 2901–3000 (out of 3698)

Page: Previous 1 …25 26 27 28 29 30 31 32 33 34 35 … 37 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4545 1094.2112 3279.6118 3279.6488 -11.3 1 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 ENGNGVMGVVGTLLAMIVAPFGAMIVQMAVSR + 3 Oxidation (M)
3256 686.0111 2055.0115 2055.0194 -3.85 1 0 1 +1Score > 40 indicates identity
Score > 13 indicates homology		 LAAEMLASTIGSSAQLAYDK + Oxidation (M)
4055 887.4655 2659.3747 2659.4043 -11.1 1 0 1 +1Score > 37 indicates identity
Score > 13 indicates homology		 APSVLLSIFIYNASKPQNLECAPK
4070 895.7526 2684.2360 2684.2606 -9.17 1 0 1 +1Score > 37 indicates identity
Score > 13 indicates homology		 TRNDTIFQVFNQYGIPLVADGGQE + 3 Deamidated (NQ)
240 530.3010 529.2937 529.2972 -6.62 0 0 1 +1Score > 39 indicates identity
Score > 13 indicates homology		 AIGNR
4090 901.4577 2701.3513 2701.3051 17.1 1 0 1 +1Score > 37 indicates identity
Score > 13 indicates homology		 LLLQQGAAANDQDLQGRTALMLACE + 2 Deamidated (NQ)
4492 802.4200 3205.6509 3205.5938 17.8 1 0 1 +1Score > 35 indicates identity
Score > 13 indicates homology		 LVLDHTNNISNKCNNGVTPLHNAILYNR + 2 Deamidated (NQ)
3736 774.0910 2319.2512 2319.2699 -8.07 1 0 1 +1Score > 35 indicates identity
Score > 13 indicates homology		 LLAEGGWLIGNVAVQVVGNRPR + 2 Deamidated (NQ)
3996 861.4746 2581.4020 2581.3940 3.09 0 0 1 +1Score > 34 indicates identity
Score > 13 indicates homology		 TWNIGVVLLLLVMMTAFVGYVLP + Deamidated (NQ); 2 Oxidation (M)
4313 993.5211 2977.5415 2977.5032 12.9 1 0 1 +1Score > 35 indicates identity
Score > 13 indicates homology		 AVSLASNAQKAGAQALLSVAPYYNKPSQE + 2 Deamidated (NQ)
4490 1068.8577 3203.5513 3203.5146 11.4 0 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 TQQSITVQVSDVNDNAPAFAQTSYTLFVR + 4 Deamidated (NQ)
4355 1010.5574 3028.6504 3028.7035 -17.5 1 0 1 +1Score > 32 indicates identity
Score > 13 indicates homology		 LALVVIFLLLASLFQPLTAQSSCPGNKK + Deamidated (NQ)
4517 1079.8979 3236.6719 3236.6131 18.2 1 0 1 +1Score > 34 indicates identity
Score > 13 indicates homology		 IMSMVAPSGPVYQAGTLSGNPLAMTAGIKTLE + 2 Oxidation (M)
3776 590.3205 2357.2529 2357.2162 15.6 1 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 ISPSIDLTVQAVKGMAGFSHQR + Oxidation (M)
4484 800.4461 3197.7553 3197.7199 11.1 1 0 1 +1Score > 30 indicates identity
Score > 13 indicates homology		 FRLLLLLTLCLTVVGWATSNYFVGAIQE + Deamidated (NQ)
4573 1114.6106 3340.8100 3340.7992 3.23 1 0 1 +1Score > 31 indicates identity
Score > 13 indicates homology		 INGQVLPFLQPIQLSAMYLAKNLLGGNAPLK + 4 Deamidated (NQ); Oxidation (M)
4443 789.9403 3155.7321 3155.6722 19.0 1 0 1 +1Score > 30 indicates identity
Score > 13 indicates homology		 NISSTGMPLSLKLGPGIIGNMFDGIQRPLK + 2 Deamidated (NQ)
4006 649.0909 2592.3345 2592.3410 -2.50 1 0 1 +1Score > 37 indicates identity
Score > 13 indicates homology		 IAYILSVLGYSDLADRIFMYNR
4510 808.9337 3231.7057 3231.7518 -14.3 1 0 1 +1Score > 33 indicates identity
Score > 13 indicates homology		 GLFHNLLVALPTGLGKTFIAATIMLNWFR + 2 Deamidated (NQ); Oxidation (M)
4233 718.8876 2871.5213 2871.4654 19.5 1 0 1 +1Score > 34 indicates identity
Score > 13 indicates homology		 DRLLINQSPPIQLVTAIFDSFNDPR + 3 Deamidated (NQ)
930 907.4694 906.4621 906.4559 6.85 0 0 1 +1Score > 41 indicates identity
Score > 13 indicates homology		 NGSFQNLK
4067 895.4497 2683.3273 2683.3125 5.52 1 0 1 +1Score > 38 indicates identity
Score > 13 indicates homology		 SHVPFILMYDSLSVAQQMTLIEK + 2 Deamidated (NQ); 2 Oxidation (M)
4339 1001.4814 3001.4224 3001.3698 17.5 1 0 1 +1Score > 36 indicates identity
Score > 13 indicates homology		 MQVQQQQQLCGNYPTIHFGSTSFKR + 3 Deamidated (NQ); Oxidation (M)
4620 1158.5143 3472.5211 3472.5518 -8.84 1 0 1 +1Score > 32 indicates identity
Score > 13 indicates homology		 HRGNNTSGFFFVDSDGSGPLEPLQLYCNITE + 2 Deamidated (NQ)
1 302.1775 301.1702
2 302.2085 301.2012
3 303.1783 302.1710
4 303.1784 302.1711
5 303.1786 302.1713
6 303.2032 302.1959
7 304.1622 303.1549
8 304.1639 303.1566
9 304.8354 303.8281
10 305.0107 304.0034
11 309.2066 308.1993
12 310.1826 309.1753
13 313.2216 312.2143
14 315.6853 314.6780
15 317.1940 316.1867
16 317.2189 316.2116
17 319.1622 318.1549
18 319.2273 318.2200
19 321.2427 320.2354
20 322.1882 321.1809
21 323.2052 322.1979
22 325.2219 324.2146
23 331.2097 330.2024
24 331.2348 330.2275
25 332.8546 331.8473
26 333.1891 332.1818
27 333.2064 332.1991
28 333.2064 332.1991
29 333.2066 332.1993
30 333.2069 332.1996
31 333.2070 332.1997
32 333.2076 332.2003
33 333.2140 332.2067
34 335.2219 334.2146
35 335.2219 334.2146
36 335.2226 334.2153
37 335.2229 334.2156
38 335.2232 334.2159
39 335.2232 334.2159
40 335.2422 334.2349
41 337.2381 336.2308
42 337.2587 336.2514
43 340.6946 339.6873
44 345.2248 344.2175
45 345.2250 344.2177
46 345.2253 344.2180
47 345.2256 344.2183
48 345.2257 344.2184
49 349.2224 348.2151
50 349.2228 348.2155
51 351.2167 350.2094
52 351.2173 350.2100
53 351.2177 350.2104
54 351.2177 350.2104
55 351.2183 350.2110
56 351.2185 350.2112
57 351.2382 350.2309
58 351.2383 350.2310
59 351.2390 350.2317
60 351.7116 350.7043
61 353.2539 352.2466
62 353.2547 352.2474
63 353.6988 352.6915
64 356.2733 355.2660
65 357.2505 356.2432
66 358.2458 357.2385
67 359.2042 358.1969
68 359.2410 358.2337
69 359.2410 358.2337
70 359.2411 358.2338
71 359.2411 358.2338
72 359.2412 358.2339
73 359.2419 358.2346
74 359.2660 358.2587
75 360.2254 359.2181
76 361.1984 360.1911
Page: Previous 1 …25 26 27 28 29 30 31 32 33 34 35 … 37 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/