MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita1 sp
MS data file : PRT1270_T-BRSC_1_20250714114344.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 22:50:29 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,938

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 2601–2700 (out of 3698)

Page: Previous 1 …22 23 24 25 26 27 28 29 30 31 32 … 37 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2837 601.2758 1800.8056 1800.7762 16.3 1 2 1 +1Score > 38 indicates identity
Score > 14 indicates homology		 NSQPNDGSEDSKPVQAE
4112 910.4972 2728.4698 2728.4285 15.1 0 2 1 +1Score > 33 indicates identity
Score > 14 indicates homology		 LALFLSVEPTPDLTPQFMQLLLPE + Deamidated (NQ); Oxidation (M)
4175 932.8424 2795.5054 2795.4930 4.44 1 2 0.7 +1Score > 33 indicates identity
Score > 13 indicates homology		 KPVGAPPASQIPGLSDLRDSPNVNLPR + Deamidated (NQ)
4534 815.6870 3258.7189 3258.6707 14.8 1 2 1 +1Score > 33 indicates identity
Score > 14 indicates homology		 NLLLGTACAIYLGFLVSQVGRASLQHGQAAE + 2 Deamidated (NQ)
4260 726.1550 2900.5909 2900.6487 -19.9 0 2 1 +1Score > 31 indicates identity
Score > 14 indicates homology		 GNIAAIIIEPVAGNTGVIPAKPGFLQALR + Deamidated (NQ)
4432 1050.5231 3148.5475 3148.5580 -3.35 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 LGACLTGTSPARVADGRPTLQMAFCIDVR + Oxidation (M)
3619 564.0635 2252.2249 2252.2277 -1.25 0 2 0.92 +1Score > 35 indicates identity
Score > 14 indicates homology		 QVLVIDKPAGLVVHPGAGNPDR + Deamidated (NQ)
4830 935.4788 4672.3576 4672.3596 -0.41 1 2 1 +1Score > 31 indicates identity
Score > 14 indicates homology		 GAVVDQLGGDLNSTPLHWAIRQGHLPMVILLLQHGADPTLTDGE + 2 Deamidated (NQ); Oxidation (M)
2139 740.9355 1479.8564 1479.8548 1.09 1 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 SLALQLGLPVLEVE
4242 961.1296 2880.3670 2880.3409 9.07 1 2 0.74 +1Score > 37 indicates identity
Score > 13 indicates homology		 HMDQLQQNVSIVTQQKMQPIYSVK + 6 Deamidated (NQ); 2 Oxidation (M)
4249 965.1566 2892.4480 2892.4327 5.27 1 2 0.87 +1Score > 37 indicates identity
Score > 14 indicates homology		 SDFLLHILSAMYGNLDSQIIELDNR + Oxidation (M)
3748 777.4082 2329.2028 2329.1590 18.8 1 2 0.9 +1Score > 38 indicates identity
Score > 14 indicates homology		 VNVQGKNIVLNVGFSHPVNYE + 3 Deamidated (NQ)
4625 872.7054 3486.7925 3486.7275 18.6 1 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 HMSQLPPFLVANGGVNSGFMIAQVTAAALASENK + Deamidated (NQ); Oxidation (M)
3499 1087.5540 2173.0934 2173.0952 -0.79 0 2 0.99 +1Score > 39 indicates identity
Score > 14 indicates homology		 VQGYFPIVFAMVAQAMGLSK + Deamidated (NQ); Oxidation (M)
3624 752.4367 2254.2883 2254.2532 15.5 1 2 1 +1Score > 30 indicates identity
Score > 14 indicates homology		 ARIVVLISGSGSNLQALIDAQK + 2 Deamidated (NQ)
1554 591.3655 1180.7164 1180.7067 8.26 1 2 0.78 +1Score > 31 indicates identity
Score > 13 indicates homology		 EIIQVLQLPK + Deamidated (NQ)
2483 545.9688 1634.8846 1634.8628 13.3 1 2 0.73 +1Score > 38 indicates identity
Score > 13 indicates homology		 SLHLDPSDILELGAR
4389 1028.5234 3082.5484 3082.5363 3.90 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 LTKNNSVIMPTTMAVMALLNLYFYMR + 3 Oxidation (M)
4617 694.9601 3469.7641 3469.6963 19.6 1 2 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 IPPTFANLNLAFVDLSRNMLQGDASVLFGSDK + 4 Deamidated (NQ); Oxidation (M)
4627 872.7100 3486.8109 3486.8094 0.44 1 2 0.72 +1Score > 34 indicates identity
Score > 13 indicates homology		 NLTSTILQDVTLAGGTLSLSDGVTLQLHSFKQE + Deamidated (NQ)
4628 872.9538 3487.7861 3487.8055 -5.56 1 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 GKLDIYSGCDDSIVPVMSLGGLGVVSVLSNIAPR
3219 679.3580 2035.0522 2035.0659 -6.77 1 2 0.9 +1Score > 39 indicates identity
Score > 14 indicates homology		 IRVDTFPAASQLINTLMK + 2 Deamidated (NQ); Oxidation (M)
1641 409.9010 1226.6812 1226.6983 -14.0 0 2 0.93 +1Score > 39 indicates identity
Score > 14 indicates homology		 LPQTGVVVSATR
2800 592.6706 1774.9900 1774.9617 15.9 0 2 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 ALVINQLVASQIWYR + 2 Deamidated (NQ)
4293 739.8861 2955.5153 2955.5475 -10.9 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 GKTNVILLGDSIGDLTMADGVPGVQNILK + 2 Deamidated (NQ); Oxidation (M)
4920 916.4778 6408.2937 6408.1793 17.8 1 2 0.79 +1Score > 26 indicates identity
Score > 13 indicates homology		 AGMTVKQAIVYNLLSAMMAYIGMLIGTAVGQYANNITLWIFAVTAGMFLYVALVDMLPE + 5 Deamidated (NQ); 2 Oxidation (M)
3429 715.6979 2144.0719 2144.0848 -6.04 1 2 1 +1Score > 39 indicates identity
Score > 14 indicates homology		 VLANSDVDIIAAESLTDAAQK + Deamidated (NQ)
3577 741.6859 2222.0359 2222.0022 15.1 1 2 0.89 +1Score > 39 indicates identity
Score > 14 indicates homology		 VDVDNQADNHGIHSALKTCE
2717 578.6650 1732.9732 1733.0008 -16.0 1 2 0.71 +1Score > 34 indicates identity
Score > 13 indicates homology		 IADIMSLSTSTIKLIK
4697 947.5122 3786.0197 3785.9814 10.1 1 2 0.82 +1Score > 30 indicates identity
Score > 13 indicates homology		 DALAAELAAGPMTLYSGFDPTAPSLHAGHLVPLLTLR
3279 1037.1151 2072.2156 2072.1782 18.1 1 2 1 +1Score > 27 indicates identity
Score > 14 indicates homology		 DLYYRLNVLTLNLPPLR
4224 952.8783 2855.6131 2855.5619 17.9 1 2 1 +1Score > 28 indicates identity
Score > 14 indicates homology		 SLLLINAGMAPLKPYFTGLQVPPNKR + 2 Deamidated (NQ); Oxidation (M)
3658 571.5375 2282.1209 2282.1100 4.77 1 2 0.8 +1Score > 39 indicates identity
Score > 13 indicates homology		 TDPDGQVLNSLIETLMHLQR + 3 Deamidated (NQ)
3683 766.7634 2297.2684 2297.2301 16.7 1 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 MTQDQLKQAVAQAAVDLILPK + Deamidated (NQ); Oxidation (M)
4208 944.8084 2831.4034 2831.3681 12.5 1 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 MLAAQQIIGAQDLADIQRGMAQITQE + 3 Deamidated (NQ); Oxidation (M)
3983 857.1472 2568.4198 2568.3985 8.29 1 2 1 +1Score > 31 indicates identity
Score > 14 indicates homology		 AAAQGLMAGINAVLALKNQDPFILK + 2 Deamidated (NQ)
1042 475.2563 948.4980 948.4916 6.76 0 2 0.93 +1Score > 41 indicates identity
Score > 14 indicates homology		 DIFDQLAK
3508 1092.5867 2183.1588 2183.1586 0.11 0 2 0.9 +1Score > 37 indicates identity
Score > 14 indicates homology		 SVQQAIASGITAQQIIHFLR + 3 Deamidated (NQ)
3782 788.7114 2363.1124 2363.1265 -5.98 0 2 1 +1Score > 39 indicates identity
Score > 14 indicates homology		 DKPMTPPMMPFGANLPFGPFR + Oxidation (M)
4866 1076.1488 5375.7076 5375.7333 -4.78 1 2 1 +1Score > 29 indicates identity
Score > 14 indicates homology		 FNLMKTAVLMAAITALFMAIGSVLGGQQGMAIALVVALGMNFFSYWFSDK + 2 Oxidation (M)
4264 969.8212 2906.4418 2906.4563 -4.99 0 2 0.8 +1Score > 37 indicates identity
Score > 13 indicates homology		 FVLQQPQNGTGHAVQQLLAPLQGFQGE + 2 Deamidated (NQ)
4319 996.8359 2987.4859 2987.4328 17.8 1 2 0.93 +1Score > 37 indicates identity
Score > 14 indicates homology		 TNMMTHLSKINGDIAQTTLDITHTSSR + 2 Deamidated (NQ)
3381 1061.0498 2120.0850 2120.0711 6.59 1 2 0.7 +1Score > 39 indicates identity
Score > 13 indicates homology		 NKGIQSMLDTVINYLPSPK + 3 Deamidated (NQ)
4107 907.8215 2720.4427 2720.4193 8.58 1 2 0.79 +1Score > 35 indicates identity
Score > 13 indicates homology		 TVDLNAMINLFLNLINLSKVDTQK + 4 Deamidated (NQ)
4935 809.3016 6466.3546 6466.3625 -1.23 1 2 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 VTQGITLMSGMILLTWQKIAPMSILYQISPSINTNLLMLMALTSVLVGGWGGLNQTQLR + 4 Deamidated (NQ); 3 Oxidation (M)
4629 872.9586 3487.8053 3487.7934 3.42 1 2 0.91 +1Score > 33 indicates identity
Score > 14 indicates homology		 NLTSTILQDVTLAGGTLSLSDGVTLQLHSFKQE + 2 Deamidated (NQ)
3676 765.4273 2293.2601 2293.2529 3.11 1 2 0.8 +1Score > 34 indicates identity
Score > 13 indicates homology		 KPIEVPAGVTVNVDSNNLVTVK + Deamidated (NQ)
4164 698.1138 2788.4261 2788.4290 -1.04 1 2 0.95 +1Score > 36 indicates identity
Score > 14 indicates homology		 SPRDLSHGDVATNAAMVLAKPLGTNPR + Deamidated (NQ)
4507 1075.9286 3224.7640 3224.7335 9.46 0 2 1 +1Score > 30 indicates identity
Score > 14 indicates homology		 RPSQCGALVLAGIMILINLLVPSDLQMLR + 2 Deamidated (NQ); 2 Oxidation (M)
3380 707.3687 2119.0843 2119.0606 11.2 0 2 0.99 +1Score > 39 indicates identity
Score > 14 indicates homology		 STTVNLTTLPICLSLDLQE + 2 Deamidated (NQ)
4409 1037.5658 3109.6756 3109.6196 18.0 1 2 0.71 +1Score > 32 indicates identity
Score > 13 indicates homology		 YYKADNQNSLSLSGPTPVPILGNIHQVGK
4455 529.9229 3173.4937 3173.4883 1.71 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 SGFWNFDALFVPQQHSARDAQDTFFLK + 2 Deamidated (NQ)
4694 940.2590 3757.0069 3756.9346 19.2 1 2 0.93 +1Score > 31 indicates identity
Score > 14 indicates homology		 QPGGYLLGGFGPAPEGMAMWIIGMVAAIGLALWIGAR + Oxidation (M)
3401 711.0082 2130.0028 2130.0011 0.77 1 2 1 +1Score > 39 indicates identity
Score > 14 indicates homology		 AIDQVRQCLDTIANDPGSR + 2 Deamidated (NQ)
3837 803.0618 2406.1636 2406.2114 -19.9 1 2 0.74 +1Score > 39 indicates identity
Score > 13 indicates homology		 WQVRIAGTLDPPCADSTAHALK
4302 988.4858 2962.4356 2962.4027 11.1 1 2 0.78 +1Score > 37 indicates identity
Score > 13 indicates homology		 IITYGKMPYSGMTGAQVIHMLGQNYR + 2 Deamidated (NQ); 2 Oxidation (M)
4346 1006.2318 3015.6736 3015.6505 7.64 1 2 1 +1Score > 30 indicates identity
Score > 14 indicates homology		 LTNLWPAPLAAQPLNATVTVPGSKSLSNR
3464 720.0630 2157.1672 2157.1510 7.50 0 2 0.97 +1Score > 36 indicates identity
Score > 14 indicates homology		 GFNALEPFLPILIPNYNPK + Deamidated (NQ)
4633 876.4572 3501.7997 3501.7384 17.5 1 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 QVLQPHTKEPLDGNLMDFLHGLLQLNPDMR + Deamidated (NQ); 2 Oxidation (M)
4669 906.4955 3621.9529 3621.8811 19.8 1 2 1 +1Score > 31 indicates identity
Score > 14 indicates homology		 VDPILVPDSTQAAEMLASVLTGNDLVLVQGAGNIGK + Deamidated (NQ); Oxidation (M)
4253 966.1478 2895.4216 2895.3789 14.7 1 2 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 QLAIYEAFGWDNPVFGHLTIITNME + Deamidated (NQ); Oxidation (M)
2898 913.9448 1825.8750 1825.8682 3.75 1 2 0.72 +1Score > 40 indicates identity
Score > 13 indicates homology		 RPMNAFFVWSRDQR + Deamidated (NQ); Oxidation (M)
4609 1144.5967 3430.7683 3430.7159 15.3 1 2 0.76 +1Score > 34 indicates identity
Score > 13 indicates homology		 IQDVPSLHLLRFFLNYYSNWNSLIISMK + 4 Deamidated (NQ); Oxidation (M)
4809 887.6132 4433.0296 4433.0574 -6.26 1 2 1 +1Score > 31 indicates identity
Score > 14 indicates homology		 SMAIGFINGTGLKQGAVATSVGHDAHNMSVIGTNDADMVVAANR + 4 Deamidated (NQ); 2 Oxidation (M)
4908 1194.5826 5967.8766 5967.8441 5.45 1 2 1 +1Score > 27 indicates identity
Score > 14 indicates homology		 TAVNGNMALDDIHVQIVTPWSLVDANAWGVWFNPGDWQLIVNTMSELHLVSFE + 3 Deamidated (NQ); Oxidation (M)
3490 543.7999 2171.1705 2171.1474 10.6 1 2 0.72 +1Score > 36 indicates identity
Score > 13 indicates homology		 TPKGFGILDGVVPVTTIQNSE
4247 963.5564 2887.6474 2887.6108 12.7 1 2 0.72 +1Score > 27 indicates identity
Score > 13 indicates homology		 TFVMGLILVIAVIAATLFPLWPAEMR + Oxidation (M)
3719 770.0387 2307.0943 2307.0776 7.22 1 2 0.76 +1Score > 39 indicates identity
Score > 13 indicates homology		 SFKIDNSIMVCPLHHHLDE + Oxidation (M)
4185 702.8921 2807.5393 2807.4889 17.9 1 2 0.92 +1Score > 32 indicates identity
Score > 14 indicates homology		 RPTSNGVVSSPNSTSRPALPVKSLAQR + 2 Deamidated (NQ)
1701 627.8573 1253.7000 1253.6867 10.7 1 2 1 +1Score > 38 indicates identity
Score > 14 indicates homology		 ANPALVNELLAK + 2 Deamidated (NQ)
2887 456.4897 1821.9297 1821.9261 1.97 1 2 0.76 +1Score > 40 indicates identity
Score > 13 indicates homology		 NVWSIAYVDLSTGELR
2896 457.2394 1824.9285 1824.9370 -4.65 1 2 1 +1Score > 40 indicates identity
Score > 14 indicates homology		 ATQNYKVADISLAAFGR + Deamidated (NQ)
4281 733.3945 2929.5489 2929.5327 5.53 1 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 IVLMHTPAVLTETVADTVMALMLTTAR + 2 Oxidation (M)
2227 505.2783 1512.8131 1512.8035 6.31 1 2 0.98 +1Score > 39 indicates identity
Score > 14 indicates homology		 VGELLDIGQTDKPK + Deamidated (NQ)
3920 624.5889 2494.3265 2494.2955 12.4 1 2 0.9 +1Score > 36 indicates identity
Score > 14 indicates homology		 FLNLSDSDIVQLQNVYKLVQR + 3 Deamidated (NQ)
2926 616.3235 1845.9487 1845.9472 0.79 1 2 0.97 +1Score > 40 indicates identity
Score > 14 indicates homology		 GIDVNGDIKINVANFQK + 2 Deamidated (NQ)
3324 1047.5403 2093.0660 2093.0357 14.5 1 2 0.99 +1Score > 39 indicates identity
Score > 14 indicates homology		 LDPFSSPINFFIPNENLK + 2 Deamidated (NQ)
3424 1071.5712 2141.1278 2141.1303 -1.14 0 2 0.92 +1Score > 37 indicates identity
Score > 14 indicates homology		 VGALITLFSLPSAGMQNHIR + Deamidated (NQ); Oxidation (M)
4020 874.4800 2620.4182 2620.3804 14.4 0 2 0.76 +1Score > 34 indicates identity
Score > 13 indicates homology		 TIWLLIPGWPLAFMWYISTLAE
4052 885.4722 2653.3948 2653.4301 -13.3 1 2 1 +1Score > 36 indicates identity
Score > 14 indicates homology		 NGKTALHWAVINLNPLITCYILK + 2 Deamidated (NQ)
3594 746.7219 2237.1439 2237.1587 -6.61 1 2 1 +1Score > 38 indicates identity
Score > 14 indicates homology		 GLTPSQIGVMLRDSHGVAQVR + Deamidated (NQ); Oxidation (M)
4011 651.1164 2600.4365 2600.3971 15.2 1 2 0.79 +1Score > 32 indicates identity
Score > 13 indicates homology		 QIGITCPIVPGIMPINNYKGFLR
4333 998.5021 2992.4845 2992.5150 -10.2 0 1 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 ALCAQTMLVSHPGVNVLLLDDGLQHYK + Deamidated (NQ)
4045 530.6513 2648.2201 2648.2714 -19.3 0 1 0.76 +1Score > 37 indicates identity
Score > 13 indicates homology		 TFVGADINTIVMTNLLSGMDYNVK + Deamidated (NQ); 2 Oxidation (M)
4519 810.4207 3237.6537 3237.5969 17.5 1 1 0.9 +1Score > 35 indicates identity
Score > 14 indicates homology		 VALQSGADLVFETPFSTAVEPADLFSLGNIE + Deamidated (NQ)
2905 612.6594 1834.9564 1834.9200 19.8 1 1 0.93 +1Score > 39 indicates identity
Score > 14 indicates homology		 VDVSTQPQLQIESVYK + 2 Deamidated (NQ)
3995 646.3382 2581.3237 2581.3105 5.12 1 1 0.83 +1Score > 37 indicates identity
Score > 13 indicates homology		 IAVCTQRLTQAGAQPHLMDGSALK + Oxidation (M)
4576 836.4262 3341.6757 3341.7015 -7.71 1 1 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 VGDFPAIKSMGLNNLWIDVFVMGVMLVGYR + Deamidated (NQ)
4463 1061.5228 3181.5466 3181.5682 -6.80 1 1 0.75 +1Score > 36 indicates identity
Score > 13 indicates homology		 LAMHGTHNMLNSLAAIGVATQMGIADDKIR + Deamidated (NQ); 2 Oxidation (M)
2842 601.3509 1801.0309 1801.0350 -2.27 1 1 1 +1Score > 33 indicates identity
Score > 14 indicates homology		 GVATVVTKLFNVVQPTK + Deamidated (NQ)
2739 876.0055 1749.9964 1749.9876 5.05 0 1 0.83 +1Score > 33 indicates identity
Score > 13 indicates homology		 QLPDVQLLAQQLLLR + 3 Deamidated (NQ)
3820 797.4335 2389.2787 2389.3158 -15.5 0 1 0.99 +1Score > 36 indicates identity
Score > 14 indicates homology		 YPLLDLYTPPTTPPARPPKPR
3985 516.2684 2576.3056 2576.3082 -1.02 1 1 1 +1Score > 37 indicates identity
Score > 14 indicates homology		 NVDPVGVHTGDSITVAPALTLTDRE
4078 898.4351 2692.2835 2692.2724 4.12 1 1 0.96 +1Score > 37 indicates identity
Score > 14 indicates homology		 MANSFAARIFTTLSDLQTNMANLK + 3 Deamidated (NQ); 2 Oxidation (M)
3705 1153.5480 2305.0814 2305.0605 9.11 1 1 1 +1Score > 39 indicates identity
Score > 14 indicates homology		 QTTGSNQQSTIKTPNGGGQPMR + 2 Deamidated (NQ); Oxidation (M)
3913 831.7576 2492.2510 2492.2884 -15.0 1 1 0.94 +1Score > 38 indicates identity
Score > 14 indicates homology		 LLTTGNASTGHDQALFNRLGLHR + Deamidated (NQ)
4769 814.8018 4068.9726 4068.9531 4.79 1 1 1 +1Score > 33 indicates identity
Score > 14 indicates homology		 CGMIYMEPQMLGWRPLMVSWINTLPQSVSIIQKE + 2 Deamidated (NQ); 2 Oxidation (M)
3879 821.1111 2460.3115 2460.2649 18.9 1 1 0.86 +1Score > 35 indicates identity
Score > 13 indicates homology		 ISSFHQKQLPQDIGYTDTVGVK
3884 822.4446 2464.3120 2464.3433 -12.7 1 1 0.87 +1Score > 36 indicates identity
Score > 13 indicates homology		 MIPIPRVTDVNKPPLSLIMDAK + Deamidated (NQ); Oxidation (M)
716 822.4064 821.3991 821.3953 4.68 0 1 1 +1Score > 41 indicates identity
Score > 14 indicates homology		 MAALSDAK + Oxidation (M)
Page: Previous 1 …22 23 24 25 26 27 28 29 30 31 32 … 37 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/