MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita1 sp
MS data file : PRT1270_T-BRSC_1_20250714114344.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 22:50:29 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,938

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 2501–2600 (out of 3698)

Page: Previous 1 …21 22 23 24 25 26 27 28 29 30 31 … 37 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4655 892.2274 3564.8805 3564.8679 3.53 1 3 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 RPLLLTSVSGMCITSMLIGVAFTLQKMQLLPE + 2 Deamidated (NQ); Oxidation (M)
3127 663.0242 1986.0508 1986.0568 -3.04 1 2 1 +1Score > 38 indicates identity
Score > 15 indicates homology		 VAVILMAGGQGTRLGSSQPK + Deamidated (NQ); Oxidation (M)
4387 770.8819 3079.4985 3079.5132 -4.76 1 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 SRYNVDVAQLPGADLSQLTSAQAASLMQK + 2 Deamidated (NQ); Oxidation (M)
4548 824.4512 3293.7757 3293.7476 8.54 1 2 0.82 +1Score > 31 indicates identity
Score > 14 indicates homology		 TNTAQVVMMLATNATPQPLRVGLATTHLALK + Deamidated (NQ); 2 Oxidation (M)
3602 1122.1229 2242.2312 2242.2144 7.53 1 2 0.6 +1Score > 34 indicates identity
Score > 13 indicates homology		 MNIILFGPPGAGKGTQAQSIVK + Oxidation (M)
4391 772.9274 3087.6805 3087.6447 11.6 1 2 0.71 +1Score > 31 indicates identity
Score > 13 indicates homology		 SNTLAGQEVLVNLLLALLLDVMTVSGMQK + 2 Deamidated (NQ); Oxidation (M)
3565 738.6880 2213.0422 2213.0423 -0.036 1 2 0.94 +1Score > 39 indicates identity
Score > 15 indicates homology		 TCSSQLVHHIPEASLNYQK + 2 Deamidated (NQ)
3581 558.2545 2228.9889 2228.9895 -0.29 1 2 0.64 +1Score > 37 indicates identity
Score > 13 indicates homology		 SPYHDACPATQQPSVIQAEK + 3 Deamidated (NQ)
1752 640.8864 1279.7582 1279.7500 6.48 1 2 0.99 +1Score > 33 indicates identity
Score > 15 indicates homology		 SVHDILINLKK + Deamidated (NQ)
4109 908.0752 2721.2038 2721.1752 10.5 0 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 FMSDASDVPILLDADTGYGNFNNAR + 3 Deamidated (NQ); Oxidation (M)
3892 825.0925 2472.2557 2472.2206 14.2 1 2 0.78 +1Score > 38 indicates identity
Score > 14 indicates homology		 MIIQYAIAGQENLLVVGTDHAAE + Deamidated (NQ); Oxidation (M)
4337 749.6394 2994.5285 2994.5381 -3.22 0 2 0.83 +1Score > 36 indicates identity
Score > 14 indicates homology		 TGGVVGMFTVGLGLLGACCVVLVYAADAPK
2916 369.1916 1840.9216 1840.9101 6.25 1 2 0.75 +1Score > 40 indicates identity
Score > 14 indicates homology		 QSNLHRVLMDLQNQK + 2 Deamidated (NQ); Oxidation (M)
3957 844.4316 2530.2730 2530.3206 -18.8 0 2 0.72 +1Score > 38 indicates identity
Score > 14 indicates homology		 TLAPNPSLLLLDEPFSALDFQTK + Deamidated (NQ)
3326 699.3410 2095.0012 2095.0368 -17.0 1 2 0.97 +1Score > 39 indicates identity
Score > 15 indicates homology		 VSGQTQFNGVNVLAKDGSMK + Oxidation (M)
3980 642.5952 2566.3517 2566.3539 -0.85 0 2 0.88 +1Score > 36 indicates identity
Score > 14 indicates homology		 SCDMGLGVPFNIASYALLTILIAK
4211 948.4973 2842.4701 2842.4873 -6.07 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 FVKIMGNLNLPKPQQIDFAVPANMR + 2 Deamidated (NQ)
4263 727.3638 2905.4261 2905.4531 -9.30 1 2 0.72 +1Score > 37 indicates identity
Score > 14 indicates homology		 LQSSSPSYPIMASLDIARAYVQHIIE + Deamidated (NQ); Oxidation (M)
3243 682.3720 2044.0942 2044.1052 -5.38 1 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 LSLSSSSIQVNQKQGLLIE + Deamidated (NQ)
4884 956.0033 5729.9761 5729.9122 11.2 1 2 1 +1Score > 27 indicates identity
Score > 15 indicates homology		 KVFPLLGGIFLFILFQNLLGLVPGCDAPTANVNTNAAMALFVFGYYNYQGLK + 5 Deamidated (NQ); Oxidation (M)
4266 727.8623 2907.4201 2907.4007 6.66 1 2 0.74 +1Score > 37 indicates identity
Score > 14 indicates homology		 LVSHNIQTELSHSMHTLNIQWMQK + Deamidated (NQ); 2 Oxidation (M)
4453 1058.5356 3172.5850 3172.6188 -10.7 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 NELMVLGFISLLLTFGQNYIASICVPSR + 2 Deamidated (NQ); Oxidation (M)
4794 1049.7628 4195.0221 4195.0547 -7.78 1 2 0.94 +1Score > 32 indicates identity
Score > 15 indicates homology		 CFVNFSLFQSLPDAWGIDQIFPIMPLSGLDQQPTRR + 2 Deamidated (NQ)
3756 585.0383 2336.1241 2336.1179 2.65 1 2 0.77 +1Score > 39 indicates identity
Score > 14 indicates homology		 NASKGPHSPQVPSQVQSPMTSR + Deamidated (NQ); Oxidation (M)
4726 991.4544 3961.7885 3961.8352 -11.8 1 2 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 ACVNGTMNGLCTILDTNMAGLGETKPAHDMVVTIVNE + Oxidation (M)
3510 728.7298 2183.1676 2183.1474 9.26 1 2 0.7 +1Score > 36 indicates identity
Score > 13 indicates homology		 QVPLPAGIYNLDDLKALGQR + 3 Deamidated (NQ)
4371 765.6198 3058.4501 3058.4151 11.4 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 SYIPNDIYLDDETQQVMIITGPNMAGK + Deamidated (NQ); 2 Oxidation (M)
3642 1134.0730 2266.1314 2266.1086 10.1 1 2 0.88 +1Score > 39 indicates identity
Score > 14 indicates homology		 INISPLGCSAMATTGFNLNRK + 2 Deamidated (NQ)
4126 916.7764 2747.3074 2747.3297 -8.12 1 2 0.91 +1Score > 38 indicates identity
Score > 14 indicates homology		 CPSLRQAVQLTHQQQGQVGPQQVR + 5 Deamidated (NQ)
4421 781.6294 3122.4885 3122.5408 -16.7 1 2 0.72 +1Score > 36 indicates identity
Score > 13 indicates homology		 RDSTGSFPSQTSDLPPPTSSLQALLAAYSK + Deamidated (NQ)
4616 868.4463 3469.7561 3469.7260 8.68 1 2 0.83 +1Score > 35 indicates identity
Score > 14 indicates homology		 MAATVSTIGAVNRTTLNNSNYGGLVPNSAFLGSR + Deamidated (NQ); Oxidation (M)
3685 766.7678 2297.2816 2297.2929 -4.95 1 2 1 +1Score > 33 indicates identity
Score > 15 indicates homology		 NLLAAVGAQQQMLKLTIWGVK + Oxidation (M)
4248 723.6340 2890.5069 2890.4786 9.78 0 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 LNLSYSQFSVFGSILNMGAVLGAITSGK + Deamidated (NQ); Oxidation (M)
3237 510.7723 2039.0601 2039.0912 -15.3 1 2 1 +1Score > 38 indicates identity
Score > 15 indicates homology		 WIVAQNAAAGTDVTITPRR
3903 828.1082 2481.3028 2481.3023 0.19 1 2 0.76 +1Score > 36 indicates identity
Score > 14 indicates homology		 QGVLCRDLHPGNLLLDQAGHIR
4032 659.8141 2635.2273 2635.2687 -15.7 1 2 0.83 +1Score > 37 indicates identity
Score > 14 indicates homology		 LNKVQQQDTYVDVIVQMSAAPASE + 2 Deamidated (NQ)
4571 1114.6033 3340.7881 3340.7554 9.78 1 2 1 +1Score > 32 indicates identity
Score > 15 indicates homology		 ILSAIDYLHSLEPPIIHGNINAKNILLDNE + 2 Deamidated (NQ)
4810 896.8446 4479.1866 4479.2721 -19.1 1 2 0.63 +1Score > 32 indicates identity
Score > 13 indicates homology		 QAQNHVVVFLPIYMTSEVLPIHFLSNILNLMCFVALFQ + 2 Deamidated (NQ); 2 Oxidation (M)
3968 849.8264 2546.4574 2546.4320 9.98 1 2 1 +1Score > 28 indicates identity
Score > 15 indicates homology		 GPVATLLVQNGTLKAGDVVAAGPVLGK + 2 Deamidated (NQ)
4075 897.4591 2689.3555 2689.3051 18.7 1 2 0.95 +1Score > 37 indicates identity
Score > 15 indicates homology		 DRTLDQQCTVSRPGLAMIAGALAVE + 2 Deamidated (NQ); Oxidation (M)
4161 929.5063 2785.4971 2785.5059 -3.15 0 2 0.93 +1Score > 33 indicates identity
Score > 14 indicates homology		 MLPVLFVTFVPSMMLAQIMTLFIK + Oxidation (M)
2575 557.3361 1668.9865 1668.9563 18.1 1 2 0.94 +1Score > 30 indicates identity
Score > 14 indicates homology		 SRLPLLDLNIYVPR + Deamidated (NQ)
4921 916.4781 6408.2958 6408.2510 6.98 1 2 1 +1Score > 26 indicates identity
Score > 15 indicates homology		 LTPNTFLIILAVVVIVALIIIFMQSSSNGNNSSSPAAVPQMGFPLNTTMRANPFVATPQR + 8 Deamidated (NQ); 2 Oxidation (M)
4414 1040.2043 3117.5911 3117.6459 -17.6 1 2 1 +1Score > 35 indicates identity
Score > 15 indicates homology		 LGIPVVAILDSNSDPRGVTFPIPGNDDAIR
3074 650.3768 1948.1086 1948.1357 -13.9 0 2 0.78 +1Score > 32 indicates identity
Score > 14 indicates homology		 VLLGLSGGVDSSVVGVLLHK
3946 631.5906 2522.3333 2522.3268 2.58 1 2 0.91 +1Score > 36 indicates identity
Score > 14 indicates homology		 FLGVDEQVQLADLLPRPALAQVE + 2 Deamidated (NQ)
4464 1061.5239 3181.5499 3181.4934 17.7 1 2 0.64 +1Score > 36 indicates identity
Score > 13 indicates homology		 TIIVNSNPATIMTDEDMADAVYIEPLTVE + Deamidated (NQ); Oxidation (M)
3618 564.0347 2252.1097 2252.1504 -18.1 1 2 0.96 +1Score > 39 indicates identity
Score > 15 indicates homology		 SMSVNISTMSAIVAAGAGARVVK + Deamidated (NQ); 2 Oxidation (M)
4478 1063.8793 3188.6161 3188.5621 16.9 1 2 0.78 +1Score > 36 indicates identity
Score > 14 indicates homology		 MLSSTFLDESPSISPNGIMIIYSSTQGLGK + Oxidation (M)
4099 903.4787 2707.4143 2707.4030 4.17 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 TLTSLPKNLEPVFYNAAQTLLMPK + 3 Deamidated (NQ); Oxidation (M)
4203 942.5109 2824.5109 2824.4656 16.0 0 2 0.75 +1Score > 34 indicates identity
Score > 13 indicates homology		 WIGTGLLCTGLSAFLLVACLLDFQR + Deamidated (NQ)
3119 661.3265 1980.9577 1980.9826 -12.6 0 2 0.84 +1Score > 40 indicates identity
Score > 14 indicates homology		 SAVQTYLANQPSLMNVTK + Deamidated (NQ); Oxidation (M)
3710 1154.0535 2306.0924 2306.0962 -1.64 1 2 1 +1Score > 39 indicates identity
Score > 15 indicates homology		 MNNLIKAYAAGVMSAAFLFGSE + 2 Deamidated (NQ)
4244 962.7993 2885.3761 2885.3315 15.5 1 2 0.95 +1Score > 37 indicates identity
Score > 14 indicates homology		 QALEDNAAAVILTHNHPSGVAEPSQADE + 2 Deamidated (NQ)
2698 866.0013 1729.9880 1729.9648 13.5 1 2 0.92 +1Score > 33 indicates identity
Score > 14 indicates homology		 IDRINILQATLLAMK + 2 Deamidated (NQ); Oxidation (M)
4085 898.4499 2692.3279 2692.3312 -1.24 1 2 0.8 +1Score > 38 indicates identity
Score > 14 indicates homology		 NPIITMINSGARGNISNYVQLAGMR + 3 Deamidated (NQ)
4142 922.1303 2763.3691 2763.3173 18.7 1 2 0.85 +1Score > 38 indicates identity
Score > 14 indicates homology		 LITRMYQQNYLVYLVNDSNQNR + 3 Deamidated (NQ); Oxidation (M)
4330 998.4991 2992.4755 2992.4272 16.1 1 2 0.7 +1Score > 37 indicates identity
Score > 13 indicates homology		 IQINAFAEQTPVVMAPNMSVGVNLMWK + 5 Deamidated (NQ)
4354 1010.5552 3028.6438 3028.6242 6.47 1 2 0.98 +1Score > 32 indicates identity
Score > 15 indicates homology		 QLGSNMVVPQAKMALVLSSPLWKPVFR + Deamidated (NQ); 2 Oxidation (M)
1744 426.5797 1276.7173 1276.7139 2.61 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 YQGKVGVVIGTR + Deamidated (NQ)
3640 1134.0710 2266.1274 2266.1007 11.8 1 2 0.92 +1Score > 39 indicates identity
Score > 14 indicates homology		 TNIVSTGQALMVLIMGGQMER + 2 Deamidated (NQ); Oxidation (M)
4875 1118.7444 5588.6856 5588.6715 2.53 1 2 0.78 +1Score > 28 indicates identity
Score > 14 indicates homology		 NQPAYYLPSYAPTAPTTFYSDFANFNVTRSQDFASVPAVANSSDVKPIIIK + 6 Deamidated (NQ)
3563 738.0299 2211.0679 2211.0565 5.14 1 2 0.86 +1Score > 39 indicates identity
Score > 14 indicates homology		 PVVSLAQMMESGVHFGHQTR + Deamidated (NQ)
4255 966.8281 2897.4625 2897.4845 -7.60 0 2 1 +1Score > 37 indicates identity
Score > 15 indicates homology		 VIQDVVNIGVGGSDLGPLMVTHALSDFK + Deamidated (NQ); Oxidation (M)
4599 681.1671 3400.7991 3400.7880 3.26 1 2 0.76 +1Score > 32 indicates identity
Score > 13 indicates homology		 GARAVVVGASNIVGKPMAMLLLQGGATVTICNSK + 2 Deamidated (NQ); Oxidation (M)
1436 378.8709 1133.5909 1133.5791 10.4 0 2 0.94 +1Score > 42 indicates identity
Score > 14 indicates homology		 QMALLPFVAE + Oxidation (M)
4318 747.1385 2984.5249 2984.5602 -11.8 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 SRVFNIISIIMVSMLILSLGAFANNNK + 4 Deamidated (NQ); Oxidation (M)
4785 831.6284 4153.1056 4153.1340 -6.83 1 2 0.71 +1Score > 32 indicates identity
Score > 13 indicates homology		 LLGMSTQNYALMQVAGQEGTFSLVALPHVASAQPIQKPR + 2 Deamidated (NQ)
3048 641.6870 1922.0392 1922.0221 8.88 0 2 0.95 +1Score > 36 indicates identity
Score > 14 indicates homology		 QQLSNGSLLIQNILHSR + 2 Deamidated (NQ)
4781 1035.5017 4137.9777 4137.9057 17.4 1 2 0.89 +1Score > 33 indicates identity
Score > 14 indicates homology		 AGLPLYRYFGGSGPMAMPVPMMNVINGGAHANNSLDIQE + Deamidated (NQ); 3 Oxidation (M)
4101 903.4880 2707.4422 2707.4924 -18.5 0 2 0.81 +1Score > 35 indicates identity
Score > 14 indicates homology		 SYILLGCIVILIQALPAHWVWDK
4696 946.5005 3781.9729 3782.0462 -19.4 1 2 0.91 +1Score > 32 indicates identity
Score > 14 indicates homology		 NSSTYTLLRWPILIFVFSWIGILGIFYFMIR + Oxidation (M)
3144 666.3771 1996.1095 1996.0703 19.6 1 2 1 +1Score > 34 indicates identity
Score > 15 indicates homology		 LKNDMAVPTPPPPPVPPTK + Deamidated (NQ)
4304 988.7838 2963.3296 2963.3205 3.07 1 2 0.89 +1Score > 35 indicates identity
Score > 14 indicates homology		 DKNFGFNAQDMQYVDMIQAGIIDPAK + 3 Deamidated (NQ); 2 Oxidation (M)
4428 1046.2261 3135.6565 3135.7094 -16.9 1 2 0.79 +1Score > 34 indicates identity
Score > 14 indicates homology		 RPLDAHLALVNQHPIGPFPRVQSPPHLK + 2 Deamidated (NQ)
3740 774.7530 2321.2372 2321.2366 0.25 1 2 0.96 +1Score > 36 indicates identity
Score > 14 indicates homology		 NVLVSSPTGSGKTLTAFLSIISE + Deamidated (NQ)
4119 913.1347 2736.3823 2736.3826 -0.13 1 2 0.82 +1Score > 37 indicates identity
Score > 14 indicates homology		 FICMIALTSGILASGLSQSVSAHTEK + Oxidation (M)
2985 940.5048 1878.9950 1878.9795 8.29 1 2 1 +1Score > 38 indicates identity
Score > 15 indicates homology		 VKTGVLNDVISQAIMMK + Deamidated (NQ); 2 Oxidation (M)
4600 682.1797 3405.8621 3405.8925 -8.91 1 2 0.67 +1Score > 30 indicates identity
Score > 13 indicates homology		 AWLLFAHQGAEPGHKTLLAALQAEPLLALGLR + Deamidated (NQ)
4184 702.8907 2807.5337 2807.5554 -7.73 1 2 0.97 +1Score > 32 indicates identity
Score > 14 indicates homology		 NMVAVLLSVLVSLLGFLTLNRGFCR + Oxidation (M)
4407 1034.5061 3100.4965 3100.5451 -15.7 1 2 1 +1Score > 36 indicates identity
Score > 15 indicates homology		 STAQLQQQLDLVYSYIISSVSQRNLNK + 5 Deamidated (NQ)
2920 614.6919 1841.0539 1841.0635 -5.25 1 2 0.88 +1Score > 32 indicates identity
Score > 14 indicates homology		 VPEPTRLAHNLLQVVR
3781 788.1175 2361.3307 2361.3743 -18.5 1 2 1 +1Score > 31 indicates identity
Score > 15 indicates homology		 NIRLSVAAIVTDVLPNGNLIIR + Deamidated (NQ)
2856 602.6407 1804.9003 1804.8989 0.76 0 2 0.89 +1Score > 40 indicates identity
Score > 14 indicates homology		 SNGMLLAAGADADLLTTR + Oxidation (M)
4326 998.4952 2992.4638 2992.4384 8.48 1 2 0.7 +1Score > 37 indicates identity
Score > 13 indicates homology		 EQISAYGDQIPIVMAPNMAVGVNLMWK + 2 Deamidated (NQ); Oxidation (M)
4334 998.8274 2993.4604 2993.4377 7.57 1 2 0.76 +1Score > 37 indicates identity
Score > 13 indicates homology		 MSVGMVFQKPNPFPMSIYENIAFGLK + Deamidated (NQ); 3 Oxidation (M)
4515 1079.8875 3236.6407 3236.6324 2.57 1 2 0.84 +1Score > 35 indicates identity
Score > 14 indicates homology		 QSASVTLWQVIGNSVMAFILGSMFYKVMK + 2 Deamidated (NQ)
3899 826.7862 2477.3368 2477.3100 10.8 1 2 0.91 +1Score > 34 indicates identity
Score > 14 indicates homology		 SLAQTLRGALLTDFMGAAWIAVR + Deamidated (NQ); Oxidation (M)
3956 844.4273 2530.2601 2530.2857 -10.1 1 2 0.82 +1Score > 38 indicates identity
Score > 14 indicates homology		 QGPVLVSVFVNPLQFGPAEDFDR
4173 932.1445 2793.4117 2793.4623 -18.1 1 2 0.81 +1Score > 37 indicates identity
Score > 14 indicates homology		 GTTYLSPKDNGMLIIDGQIIFGVVDK
2681 862.0267 1722.0388 1722.0403 -0.87 1 2 1 +1Score > 27 indicates identity
Score > 14 indicates homology		 VNIVPVIAKADTLTLR
2700 866.0189 1730.0232 1730.0171 3.56 0 2 1 +1Score > 28 indicates identity
Score > 14 indicates homology		 LILPVYNPAFFIPVK
1284 535.2349 1068.4552 1068.4360 18.0 0 2 0.83 +1Score > 38 indicates identity
Score > 14 indicates homology		 FTNSDDVDR + Deamidated (NQ)
3773 785.7710 2354.2912 2354.2919 -0.30 1 2 1 +1Score > 34 indicates identity
Score > 14 indicates homology		 LYPEPLLVANAIKASLPQSAMK + Deamidated (NQ)
4850 1021.3647 5101.7871 5101.7599 5.33 1 2 1 +1Score > 26 indicates identity
Score > 14 indicates homology		 MTPLPAGNGSVPNCSWAAVLSRQWAVGAALSITILVIVAGNLLVIVAIAK + 4 Deamidated (NQ); Oxidation (M)
3643 1134.0732 2266.1318 2266.1086 10.3 1 2 0.9 +1Score > 39 indicates identity
Score > 14 indicates homology		 INISPLGCSAMATTGFNLNRK + 2 Deamidated (NQ)
3863 813.1059 2436.2959 2436.3095 -5.59 1 2 0.92 +1Score > 36 indicates identity
Score > 14 indicates homology		 ILGIMLLSMHNLLFYNRLMK + Deamidated (NQ); Oxidation (M)
3164 670.0583 2007.1531 2007.1616 -4.24 1 2 0.98 +1Score > 30 indicates identity
Score > 14 indicates homology		 VIITQNLVVIAGEINSPVK + Deamidated (NQ)
4634 1168.5923 3502.7551 3502.7330 6.30 1 2 1 +1Score > 35 indicates identity
Score > 14 indicates homology		 NSQFIALMPTAASAQISDVSEGFAPLFTNLFSK + Deamidated (NQ)
4932 924.6261 6465.3318 6465.3889 -8.83 1 2 0.9 +1Score > 26 indicates identity
Score > 14 indicates homology		 VINSMLAVGVNPPFTITDSGLAMDLGDGLALGGSKLIINLGPGLQMSNGAITLALDAALPLQYR + 2 Deamidated (NQ); Oxidation (M)
Page: Previous 1 …21 22 23 24 25 26 27 28 29 30 31 … 37 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/