MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita1 sp
MS data file : PRT1270_T-BRSC_1_20250714114344.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 22:50:29 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,938

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 1901–2000 (out of 3698)

Page: Previous 1 …15 16 17 18 19 20 21 22 23 24 25 … 37 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3947 841.7866 2522.3380 2522.3090 11.5 1 6 0.65 +1Score > 35 indicates identity
Score > 17 indicates homology		 QFVLGNLDVTIIAQAPKMAPHIE + 2 Deamidated (NQ); Oxidation (M)
1782 649.3104 1296.6062 1296.6058 0.32 0 6 0.87 +1Score > 40 indicates identity
Score > 18 indicates homology		 NTTHPNDQTIR + Deamidated (NQ)
2703 578.2625 1731.7657 1731.7846 -10.9 1 6 0.62 +1Score > 39 indicates identity
Score > 17 indicates homology		 QVDGQKIHSSTMNNR + 2 Deamidated (NQ); Oxidation (M)
3260 686.7150 2057.1232 2057.0966 12.9 1 6 0.5 +1Score > 35 indicates identity
Score > 16 indicates homology		 EPEIIDVATLLTNMGAIIK + Deamidated (NQ); Oxidation (M)
4555 662.3664 3306.7956 3306.8380 -12.8 1 6 0.65 +1Score > 31 indicates identity
Score > 17 indicates homology		 NFLLLLLAAYALGSTPFAIVSSRLFGLADPR + Deamidated (NQ)
2599 841.4560 1680.8974 1680.9232 -15.3 1 6 0.38 +1Score > 38 indicates identity
Score > 14 indicates homology		 ISGKPHALASALMKIE + Oxidation (M)
2883 455.4702 1817.8517 1817.8755 -13.1 1 6 0.99 +1Score > 40 indicates identity
Score > 19 indicates homology		 DKLNQSGLSLSGGQQQR + 3 Deamidated (NQ)
1203 514.8106 1027.6066 1027.6212 -14.2 0 6 0.91 +1Score > 38 indicates identity
Score > 18 indicates homology		 LLALICGLR
1441 379.2342 1134.6808 1134.6621 16.4 1 6 0.82 +1Score > 32 indicates identity
Score > 18 indicates homology		 KLNNLHIQR
1758 428.9015 1283.6827 1283.6609 17.0 1 6 0.66 +1Score > 40 indicates identity
Score > 17 indicates homology		 VEPSLGQKVPTE + Deamidated (NQ)
3593 1119.5773 2237.1400 2237.1467 -2.97 1 6 0.76 +1Score > 39 indicates identity
Score > 17 indicates homology		 SVQGIQYLPNVTKLFLNGNK + 5 Deamidated (NQ)
1206 344.5038 1030.4896 1030.5005 -10.6 0 6 0.93 +1Score > 41 indicates identity
Score > 18 indicates homology		 VMNPDLNVK + 2 Deamidated (NQ)
2615 846.9536 1691.8926 1691.9247 -18.9 1 6 0.8 +1Score > 39 indicates identity
Score > 18 indicates homology		 AVFGVKDFQQLAVIR + 2 Deamidated (NQ)
3341 702.0527 2103.1363 2103.1142 10.5 0 6 0.39 +1Score > 36 indicates identity
Score > 14 indicates homology		 NLVSLGICLPDLSIISMMK
4618 868.4514 3469.7765 3469.7262 14.5 1 6 0.63 +1Score > 35 indicates identity
Score > 17 indicates homology		 NFPMAQIPQGLTPTAPPEMPTAPPVDPAADLLR + Deamidated (NQ); Oxidation (M)
3587 744.3973 2230.1701 2230.1892 -8.59 1 6 0.36 +1Score > 37 indicates identity
Score > 14 indicates homology		 VFRPSPRQADLMIVAGTVTR + Deamidated (NQ); Oxidation (M)
3979 642.0771 2564.2793 2564.3057 -10.3 1 6 0.6 +1Score > 38 indicates identity
Score > 16 indicates homology		 AQGETVAFVPTMGNLHQGHITLVK + Deamidated (NQ); Oxidation (M)
2795 887.4505 1772.8864 1772.8614 14.1 1 6 0.82 +1Score > 40 indicates identity
Score > 18 indicates homology		 AQVAENIDAIMDVLDR + Deamidated (NQ)
3161 502.7669 2007.0385 2007.0499 -5.70 0 6 0.95 +1Score > 39 indicates identity
Score > 18 indicates homology		 VGTFPAMPLSSLFANAVLR + Deamidated (NQ); Oxidation (M)
290 593.3303 592.3230 592.3221 1.64 0 6 0.29 +1Score > 40 indicates identity
Score > 13 indicates homology		 AIDFK
398 335.7114 669.4082 669.4173 -13.6 1 6 0.99 +1Score > 34 indicates identity
Score > 19 indicates homology		 GAPKAVK
4012 522.2744 2606.3356 2606.2859 19.1 1 6 0.78 +1Score > 37 indicates identity
Score > 17 indicates homology		 VYKNMQILDVTADMTSYNILLK + 2 Deamidated (NQ); 2 Oxidation (M)
3871 611.2957 2441.1537 2441.1209 13.4 1 6 0.34 +1Score > 38 indicates identity
Score > 14 indicates homology		 YSPDAWMLNYSNPAAIVAEATR + 2 Deamidated (NQ)
4379 767.6538 3066.5861 3066.5583 9.05 0 6 0.72 +1Score > 35 indicates identity
Score > 17 indicates homology		 ATLMGIPAIAVSLVTQNDGGNYSAAAAFVVK + 2 Deamidated (NQ); Oxidation (M)
2487 546.9587 1637.8543 1637.8447 5.87 1 6 0.9 +1Score > 39 indicates identity
Score > 18 indicates homology		 LISMQKGGNLAAVYR + 2 Deamidated (NQ); Oxidation (M)
3916 832.1175 2493.3307 2493.3712 -16.3 1 6 0.81 +1Score > 35 indicates identity
Score > 18 indicates homology		 MLSMKVAVLGAGAWGTALAAHLAVR
3153 668.0248 2001.0526 2001.0531 -0.25 1 6 0.68 +1Score > 39 indicates identity
Score > 17 indicates homology		 LFRNLNIQSDVVPTLNR + 3 Deamidated (NQ)
4054 887.4412 2659.3018 2659.3454 -16.4 1 6 1 +1Score > 38 indicates identity
Score > 19 indicates homology		 LQAIKGYNFLTLKPTMYIANVNE + 3 Deamidated (NQ); Oxidation (M)
3156 1002.5248 2003.0350 2003.0224 6.31 1 6 0.4 +1Score > 39 indicates identity
Score > 15 indicates homology		 EPLARANVAYYVANGAPAR + Deamidated (NQ)
4258 967.8411 2900.5015 2900.4919 3.29 1 6 0.28 +1Score > 36 indicates identity
Score > 13 indicates homology		 AGADYLVLGRPIYAADDPKAAAQAIIQE + Deamidated (NQ)
3020 636.2828 1905.8266 1905.8488 -11.7 0 6 0.4 +1Score > 36 indicates identity
Score > 15 indicates homology		 TLQDMMNIIDYNQYK + Deamidated (NQ); Oxidation (M)
4005 648.8074 2591.2005 2591.2287 -10.9 0 6 0.4 +1Score > 37 indicates identity
Score > 15 indicates homology		 TNAVIEPMLTDQWFVAMSKPAPE + Deamidated (NQ); Oxidation (M)
1894 682.8373 1363.6600 1363.6693 -6.82 0 6 0.79 +1Score > 41 indicates identity
Score > 17 indicates homology		 FIKPTMDLASPE + Oxidation (M)
2419 806.4450 1610.8754 1610.8992 -14.7 1 6 0.96 +1Score > 38 indicates identity
Score > 18 indicates homology		 QLDISLSTVKTHLR + Deamidated (NQ)
3223 1019.0373 2036.0600 2036.0513 4.29 1 6 0.8 +1Score > 38 indicates identity
Score > 18 indicates homology		 RTLMQSLTALPVNFWSR + Deamidated (NQ); Oxidation (M)
4317 746.9120 2983.6189 2983.6311 -4.09 1 6 1 +1Score > 32 indicates identity
Score > 18 indicates homology		 LSSNTLVTTVMSNLGLHLAMRSVGVIVR + Oxidation (M)
4557 827.9548 3307.7901 3307.7374 15.9 1 6 0.81 +1Score > 31 indicates identity
Score > 18 indicates homology		 DSLMVLSDPNGNPLNSVFVAPAVTPVKGVLQK + 2 Deamidated (NQ)
712 408.7643 815.5140 815.5229 -10.8 1 6 0.6 +1Score > 35 indicates identity
Score > 16 indicates homology		 LKSVLTR
2478 545.6359 1633.8859 1633.9052 -11.8 1 6 0.76 +1Score > 38 indicates identity
Score > 17 indicates homology		 HLLRLDLNFHLSR + Deamidated (NQ)
3932 628.0793 2508.2881 2508.2981 -3.99 1 6 0.77 +1Score > 37 indicates identity
Score > 17 indicates homology		 RPGIMFADAELMGIPHTLVIGDR
1921 457.9152 1370.7238 1370.7194 3.17 0 6 0.44 +1Score > 40 indicates identity
Score > 15 indicates homology		 IIDNATDVHVFK
2330 524.2900 1569.8482 1569.8549 -4.26 1 6 0.37 +1Score > 39 indicates identity
Score > 14 indicates homology		 QLKDGGIMVIPIGGR + Deamidated (NQ); Oxidation (M)
2188 752.3877 1502.7608 1502.7801 -12.8 1 6 0.39 +1Score > 41 indicates identity
Score > 14 indicates homology		 ITSRLSTTSHTSGR
2268 769.8981 1537.7816 1537.7559 16.8 1 6 0.99 +1Score > 40 indicates identity
Score > 18 indicates homology		 NQQTIAMTEVFTR
4236 958.5125 2872.5157 2872.4957 6.95 1 6 0.45 +1Score > 35 indicates identity
Score > 15 indicates homology		 KPQVVQALQEAIDAIFLTTTLQNISE + 3 Deamidated (NQ)
2854 602.3160 1803.9262 1803.9513 -13.9 1 6 0.88 +1Score > 40 indicates identity
Score > 18 indicates homology		 NLTTNGGRVLCITSLGK + Deamidated (NQ)
4306 988.8177 2963.4313 2963.4887 -19.4 1 6 0.46 +1Score > 37 indicates identity
Score > 15 indicates homology		 MTDIVTINCMGTLRVTQLVVPGMMQR
1182 1015.6092 1014.6019 1014.6008 1.12 1 6 0.47 +1Score > 38 indicates identity
Score > 15 indicates homology		 LAILRMGNK
1747 639.8778 1277.7410 1277.7204 16.2 1 6 0.68 +1Score > 34 indicates identity
Score > 17 indicates homology		 GPIPSASGLAPRR
2498 820.9457 1639.8768 1639.8642 7.72 1 6 0.52 +1Score > 38 indicates identity
Score > 16 indicates homology		 VTPSQDLRQSSLPGR
3028 637.3331 1908.9775 1908.9590 9.67 1 6 0.95 +1Score > 39 indicates identity
Score > 18 indicates homology		 GQIPFDDFLMCAIKVR
3069 971.5426 1941.0706 1941.0782 -3.88 1 6 0.53 +1Score > 36 indicates identity
Score > 16 indicates homology		 AASNLLLKSQNDQALILK + 2 Deamidated (NQ)
2628 849.4337 1696.8528 1696.8420 6.40 1 6 0.88 +1Score > 40 indicates identity
Score > 18 indicates homology		 SIANYSSPIPNYSKR + Deamidated (NQ)
3639 1133.1184 2264.2222 2264.1874 15.4 1 6 0.73 +1Score > 36 indicates identity
Score > 17 indicates homology		 LYAAILLDCPLAVYKAQQGR + 2 Deamidated (NQ)
3966 849.4347 2545.2823 2545.3210 -15.2 1 6 0.4 +1Score > 38 indicates identity
Score > 14 indicates homology		 VIAAIASGDKAAAVAAFATAQPIMDR + Deamidated (NQ); Oxidation (M)
4024 876.7433 2627.2081 2627.2207 -4.80 1 6 0.58 +1Score > 37 indicates identity
Score > 16 indicates homology		 MNRTFNNGIGMVVVVDAANAQATAK + 4 Deamidated (NQ); 2 Oxidation (M)
4096 902.4786 2704.4140 2704.4622 -17.8 1 6 0.92 +1Score > 36 indicates identity
Score > 18 indicates homology		 VCGIALPAGLQNAQKLPEPIFTPAAK + Deamidated (NQ)
3914 624.0878 2492.3221 2492.3097 4.96 1 6 0.3 +1Score > 36 indicates identity
Score > 13 indicates homology		 VSALGANVPVYQGVRFIAMVVQR + 3 Deamidated (NQ); Oxidation (M)
4105 904.4753 2710.4041 2710.3782 9.55 1 6 0.31 +1Score > 36 indicates identity
Score > 13 indicates homology		 MSLQDPETATPNALVNIRPVVAAMR + Deamidated (NQ); Oxidation (M)
4149 925.8365 2774.4877 2774.4525 12.7 1 6 0.68 +1Score > 34 indicates identity
Score > 17 indicates homology		 VMTGFRVGPQGVQGLTGITPDLTTLAK + 2 Deamidated (NQ); Oxidation (M)
2347 526.3126 1575.9160 1575.9209 -3.12 1 6 0.88 +1Score > 32 indicates identity
Score > 18 indicates homology		 SVLNRIPGIGPNLAR
158 417.2496 416.2423 416.2383 9.64 0 6 0.95 +1Score > 52 indicates identity
Score > 18 indicates homology		 AAAGK
1126 990.5161 989.5088 989.5215 -12.9 1 6 0.62 +1Score > 42 indicates identity
Score > 16 indicates homology		 KVNLGMSLE
3344 702.6992 2105.0758 2105.0384 17.7 1 6 0.34 +1Score > 39 indicates identity
Score > 14 indicates homology		 LAMKAGNTGLVTVLAGQMPAE + 2 Deamidated (NQ); 2 Oxidation (M)
3491 725.0237 2172.0493 2172.0375 5.42 0 6 0.3 +1Score > 39 indicates identity
Score > 13 indicates homology		 IAQNGLDWYDAPALPDGVQK + 2 Deamidated (NQ)
3590 746.3792 2236.1158 2236.0868 13.0 1 6 0.95 +1Score > 39 indicates identity
Score > 18 indicates homology		 FDLTSHLVAGENTLAVMVMR + Deamidated (NQ); 2 Oxidation (M)
2287 387.9579 1547.8025 1547.7831 12.5 1 6 0.69 +1Score > 40 indicates identity
Score > 17 indicates homology		 AYEAINGGADIIDVK
2694 576.9563 1727.8471 1727.8335 7.88 1 6 0.75 +1Score > 40 indicates identity
Score > 17 indicates homology		 IVNDALIALGCMEHR + Deamidated (NQ); Oxidation (M)
3728 772.4170 2314.2292 2314.2618 -14.1 1 6 0.39 +1Score > 36 indicates identity
Score > 14 indicates homology		 ALADIQAIQAAARHQGVTARPR + Deamidated (NQ)
3882 822.1078 2463.3016 2463.3009 0.27 0 6 0.95 +1Score > 36 indicates identity
Score > 18 indicates homology		 IAVAHYAAQLSTLDINPQPLSLE
3969 850.0673 2547.1801 2547.1740 2.38 0 6 0.4 +1Score > 38 indicates identity
Score > 14 indicates homology		 VLAMASQDAQNFFQPFSSWISR + 2 Deamidated (NQ); Oxidation (M)
4162 929.5139 2785.5199 2785.5059 5.03 0 6 1 +1Score > 32 indicates identity
Score > 18 indicates homology		 MLPVLFVTFVPSMMLAQIMTLFIK + Oxidation (M)
2328 523.9535 1568.8387 1568.8133 16.2 1 6 0.79 +1Score > 39 indicates identity
Score > 17 indicates homology		 QFMIYNQKQLTR
2959 933.4964 1864.9782 1864.9604 9.54 0 6 0.93 +1Score > 38 indicates identity
Score > 18 indicates homology		 QLFQLLSDSDVNVLMK + Oxidation (M)
4234 718.8877 2871.5217 2871.4939 9.67 0 6 0.33 +1Score > 34 indicates identity
Score > 13 indicates homology		 LILQSYQQQIDSVPLTGLAPANMLLE + Deamidated (NQ); Oxidation (M)
3142 666.0635 1995.1687 1995.1631 2.80 0 6 0.36 +1Score > 28 indicates identity
Score > 14 indicates homology		 IPAGLLVMLLLWLGYLNP
644 393.2483 784.4820 784.4807 1.74 0 6 0.91 +1Score > 40 indicates identity
Score > 18 indicates homology		 LAVGAAVGK
4182 702.8892 2807.5277 2807.4817 16.4 1 6 0.69 +1Score > 33 indicates identity
Score > 17 indicates homology		 KNASSGPVFGVIGGSYSSVSLQVANLLR + Deamidated (NQ)
1613 607.3328 1212.6510 1212.6601 -7.50 0 6 0.69 +1Score > 40 indicates identity
Score > 17 indicates homology		 LQDAGAALLVLE + Deamidated (NQ)
2885 909.9903 1817.9660 1817.9709 -2.68 1 6 0.6 +1Score > 39 indicates identity
Score > 16 indicates homology		 VLAQAKNYLDVPALMR + Deamidated (NQ); Oxidation (M)
3141 998.5534 1995.0922 1995.1153 -11.5 1 6 1 +1Score > 36 indicates identity
Score > 18 indicates homology		 QDALFITRLAQGLLHLGK + 2 Deamidated (NQ)
4615 1157.5334 3469.5784 3469.5654 3.75 1 6 0.55 +1Score > 33 indicates identity
Score > 16 indicates homology		 DFAIWIMSSSQDDSHSLVMSGTGLQDIRQDK + 3 Deamidated (NQ)
1770 431.5468 1291.6186 1291.6152 2.62 1 6 0.91 +1Score > 42 indicates identity
Score > 18 indicates homology		 VMNCKLGLDIE + Deamidated (NQ)
2386 532.9813 1595.9221 1595.9359 -8.63 1 6 0.42 +1Score > 34 indicates identity
Score > 14 indicates homology		 IQALQLVVNAANSKK
2207 752.9026 1503.7906 1503.7668 15.9 0 6 0.9 +1Score > 40 indicates identity
Score > 18 indicates homology		 NSVSIQSPTLSIQK + 3 Deamidated (NQ)
2758 881.0338 1760.0530 1760.0522 0.51 0 6 0.29 +1Score > 26 indicates identity
Score > 13 indicates homology		 IVTSLVTYIIMPLIGK
1672 619.3148 1236.6150 1236.6027 10.0 1 6 0.97 +1Score > 41 indicates identity
Score > 18 indicates homology		 IDPEFFDVQK
4180 936.8177 2807.4313 2807.4705 -14.0 1 6 0.77 +1Score > 37 indicates identity
Score > 17 indicates homology		 LQVSYAIGVARPVSLNVDSFGTAKVSE + Deamidated (NQ)
2170 748.9478 1495.8810 1495.8987 -11.8 1 6 0.69 +1Score > 32 indicates identity
Score > 17 indicates homology		 KTHLLYILRPSR
3404 1067.5201 2133.0256 2133.0491 -11.0 1 6 1 +1Score > 40 indicates identity
Score > 18 indicates homology		 GPVTPVTDAEADAYFATRPR
3440 716.3954 2146.1644 2146.1382 12.2 1 6 0.37 +1Score > 36 indicates identity
Score > 14 indicates homology		 SRGANSVIALGTHPVLSGPALE + Deamidated (NQ)
4158 929.1050 2784.2932 2784.3132 -7.20 1 6 0.49 +1Score > 37 indicates identity
Score > 15 indicates homology		 LMNSGVRMNAICPGFVNTSILQSIE + 2 Deamidated (NQ); 2 Oxidation (M)
920 903.4756 902.4683 902.4821 -15.3 1 6 0.8 +1Score > 43 indicates identity
Score > 17 indicates homology		 VTRTQVAE
3534 733.0221 2196.0445 2196.0442 0.12 1 6 0.32 +1Score > 39 indicates identity
Score > 13 indicates homology		 TATIDKNNMMQYIAPQDLK + 2 Deamidated (NQ)
3225 680.3354 2037.9844 2037.9854 -0.52 0 6 0.93 +1Score > 40 indicates identity
Score > 18 indicates homology		 AQNPLGSQHISLSLSLQNE + 3 Deamidated (NQ)
3870 611.2946 2441.1493 2441.1256 9.70 0 6 0.31 +1Score > 38 indicates identity
Score > 13 indicates homology		 AHPLTFQQRPPMDNWMQLGR + 3 Deamidated (NQ); Oxidation (M)
4035 879.4461 2635.3165 2635.3163 0.077 1 6 0.73 +1Score > 38 indicates identity
Score > 17 indicates homology		 ILTPLNVQQAADSRDSLAMALYAR + 3 Deamidated (NQ); Oxidation (M)
1988 468.9225 1403.7457 1403.7521 -4.56 0 6 0.7 +1Score > 40 indicates identity
Score > 17 indicates homology		 SHTAAAAAEPLPLR
3122 661.6613 1981.9621 1981.9666 -2.31 1 6 0.34 +1Score > 40 indicates identity
Score > 13 indicates homology		 EFIQTGVSAIDGMNTLIR + 2 Deamidated (NQ); Oxidation (M)
1226 518.2987 1034.5828 1034.5661 16.1 1 6 0.86 +1Score > 38 indicates identity
Score > 17 indicates homology		 NVFQPFRK
Page: Previous 1 …15 16 17 18 19 20 21 22 23 24 25 … 37 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/