| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | Rita1 sp |
| MS data file | : | PRT1270_T-BRSC_1_20250714114344.mgf |
| Database | : | SwissProt 57.15 (515,203 sequences; 181,334,896 residues) |
| Timestamp | : | 12 Aug 2025 at 22:50:29 GMT |
Not what you expected? Try
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | GluC_Trypsin |
| Fixed modifications | : | |
| Variable modifications | : | |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,938 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 | 2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | ||||
| 6.2e-007 | 1 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | ||||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle (
) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 682.3585 | 2044.0537 | 2044.0186 | 17.1 | 0 | 9 | 0.57 | 1Score > 39 indicates identityScore > 19 indicates homology |
YYTLQILTALLMNSQNR + 3 Deamidated (NQ) | |
| 562.2921 | 1683.8545 | 1683.8719 | -10.4 | 1 | 9 | 0.51 | 1Score > 40 indicates identityScore > 19 indicates homology |
FITTLADNVYSLAEK | |
| 902.4133 | 1802.8120 | 1802.8179 | -3.22 | 1 | 9 | 0.87 | 1Score > 39 indicates identityScore > 21 indicates homology |
VTDMMYNLVNKAQSR + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 613.3381 | 1836.9925 | 1836.9833 | 5.01 | 1 | 9 | 0.89 | 1Score > 37 indicates identityScore > 21 indicates homology |
QVKPDLLVVLNPTENR + 3 Deamidated (NQ) | |
| 1159.7067 | 1158.6994 | 1158.7046 | -4.46 | 1 | 9 | 0.47 | 1Score > 32 indicates identityScore > 18 indicates homology |
SLPLLMITKK + Oxidation (M) | |
| 647.3336 | 1292.6526 | 1292.6435 | 7.09 | 0 | 9 | 0.28 | 1Score > 41 indicates identityScore > 16 indicates homology |
FVVNNMVNVLE + Oxidation (M) | |
| 833.4595 | 1664.9044 | 1664.9025 | 1.17 | 0 | 9 | 0.85 | 1Score > 37 indicates identityScore > 21 indicates homology |
SYDLPALLAFLSDIK | |
| 709.3641 | 2125.0705 | 2125.0844 | -6.56 | 1 | 9 | 1 | 1Score > 39 indicates identityScore > 21 indicates homology |
KNLGLGNFSSGQEPFFVVGK + Deamidated (NQ) | |
| 389.1931 | 776.3716 | 776.3664 | 6.71 | 1 | 9 | 0.57 | 1Score > 42 indicates identityScore > 19 indicates homology |
ETSSTPR | |
| 471.7310 | 1882.8949 | 1882.8665 | 15.1 | 1 | 9 | 0.57 | 1Score > 40 indicates identityScore > 19 indicates homology |
MATEGMILTNHDHQIR + Deamidated (NQ); Oxidation (M) | |
| 1080.5978 | 2159.1810 | 2159.2064 | -11.7 | 0 | 9 | 0.34 | 1Score > 35 indicates identityScore > 17 indicates homology |
YLPLLLIIPFLAACGSSSPK | |
| 892.7770 | 2675.3092 | 2675.2870 | 8.30 | 0 | 9 | 1 | 1Score > 38 indicates identityScore > 21 indicates homology |
VNGHIIDDIMHDIMVKPLPQGCR + 2 Deamidated (NQ); Oxidation (M) | |
| 935.4774 | 4672.3506 | 4672.3596 | -1.91 | 1 | 9 | 0.17 | 1Score > 31 indicates identityScore > 14 indicates homology |
GAVVDQLGGDLNSTPLHWAIRQGHLPMVILLLQHGADPTLTDGE + 2 Deamidated (NQ); Oxidation (M) | |
| 489.2799 | 488.2726 | 488.2707 | 3.96 | 0 | 9 | 0.73 | 1Score > 44 indicates identityScore > 20 indicates homology |
SGGIR | |
| 370.7033 | 739.3920 | 739.3977 | -7.61 | 0 | 9 | 0.72 | 1Score > 38 indicates identityScore > 20 indicates homology |
AAGHGLSK | |
| 752.3953 | 1502.7760 | 1502.7882 | -8.06 | 0 | 9 | 0.9 | 1Score > 41 indicates identityScore > 21 indicates homology |
YVQFLTHPGATLR + Deamidated (NQ) | |
| 865.4722 | 1728.9298 | 1728.9257 | 2.38 | 0 | 9 | 0.86 | 1Score > 38 indicates identityScore > 21 indicates homology |
LTANQNLIIANVTSQK + 2 Deamidated (NQ) | |
| 748.4100 | 2242.2082 | 2242.1917 | 7.35 | 1 | 9 | 0.57 | 1Score > 36 indicates identityScore > 19 indicates homology |
TRQQIQQLDTQLLTAISQR + 2 Deamidated (NQ) | |
| 458.8864 | 1373.6374 | 1373.6575 | -14.7 | 1 | 9 | 0.63 | 1Score > 40 indicates identityScore > 19 indicates homology |
TQLWAGQENGIR + 2 Deamidated (NQ) | |
| 495.9885 | 1979.9249 | 1979.9013 | 11.9 | 0 | 9 | 0.76 | 1Score > 39 indicates identityScore > 20 indicates homology |
TAGYPNVNIHNFTTSWR + 3 Deamidated (NQ) | |
| 795.3784 | 2383.1134 | 2383.1027 | 4.49 | 0 | 9 | 0.64 | 1Score > 38 indicates identityScore > 19 indicates homology |
NISVSTQLTTNQTNPSGQISYE + 2 Deamidated (NQ) | |
| 901.2006 | 2700.5800 | 2700.6306 | -18.7 | 0 | 9 | 1 | 1Score > 25 indicates identityScore > 21 indicates homology |
VLSTPPVFLLGLLLALPLGAQGLSGVR | |
| 536.9327 | 1607.7763 | 1607.8011 | -15.4 | 0 | 9 | 0.52 | 1Score > 41 indicates identityScore > 19 indicates homology |
AVMLTGGMTSAANLVR + Deamidated (NQ); Oxidation (M) | |
| 717.8661 | 1433.7176 | 1433.7336 | -11.2 | 1 | 9 | 0.7 | 1Score > 41 indicates identityScore > 20 indicates homology |
LQYHMQLRSIK + 2 Deamidated (NQ); Oxidation (M) | |
| 876.4324 | 1750.8502 | 1750.8573 | -4.03 | 1 | 9 | 0.84 | 1Score > 41 indicates identityScore > 21 indicates homology |
ARFHDAMNILGPQHK + Deamidated (NQ); Oxidation (M) | |
| 601.0164 | 1800.0274 | 1799.9993 | 15.6 | 0 | 9 | 0.44 | 1Score > 33 indicates identityScore > 18 indicates homology |
ITLDVSSLAIGDSIQIR | |
| 722.6876 | 2165.0410 | 2165.0497 | -4.01 | 1 | 9 | 0.74 | 1Score > 39 indicates identityScore > 20 indicates homology |
DAPVYVIACENMIGGSAILR + Deamidated (NQ); Oxidation (M) | |
| 451.2079 | 1800.8025 | 1800.8200 | -9.70 | 1 | 9 | 0.74 | 1Score > 38 indicates identityScore > 20 indicates homology |
AQKNLQDHSVGNIMVE + 3 Deamidated (NQ); Oxidation (M) | |
| 1006.4968 | 2010.9790 | 2010.9390 | 19.9 | 1 | 9 | 0.96 | 1Score > 40 indicates identityScore > 21 indicates homology |
ISEAIMGLDAMDQAFIDR + Oxidation (M) | |
| 860.4221 | 1718.8296 | 1718.7959 | 19.6 | 1 | 9 | 0.46 | 1Score > 40 indicates identityScore > 18 indicates homology |
NSVVDTSRDGVDNVLE + Deamidated (NQ) | |
| 510.9518 | 1529.8336 | 1529.8454 | -7.70 | 1 | 9 | 0.78 | 1Score > 39 indicates identityScore > 20 indicates homology |
GVEISTTPPIVVYR | |
| 877.9588 | 1753.9030 | 1753.9223 | -11.0 | 1 | 9 | 0.99 | 1Score > 39 indicates identityScore > 21 indicates homology |
VRNNGTLDWLRPDAK | |
| 681.3497 | 2041.0273 | 2040.9901 | 18.2 | 1 | 9 | 0.57 | 1Score > 39 indicates identityScore > 19 indicates homology |
LGLFMPGSEVKPFMGVTSE + Oxidation (M) | |
| 589.3009 | 1176.5872 | 1176.5999 | -10.8 | 1 | 9 | 0.88 | 1Score > 42 indicates identityScore > 21 indicates homology |
SPAQAYRSAAR | |
| 671.3322 | 2010.9748 | 2010.9680 | 3.34 | 1 | 9 | 0.69 | 1Score > 40 indicates identityScore > 20 indicates homology |
DYVASDQGKAQLSVMIDR + Oxidation (M) | |
| 668.8315 | 1335.6484 | 1335.6592 | -8.03 | 1 | 9 | 0.71 | 1Score > 41 indicates identityScore > 20 indicates homology |
VVTESIGQVMQK + 2 Deamidated (NQ); Oxidation (M) | |
| 506.2662 | 505.2589 | 505.2570 | 3.77 | 0 | 9 | 0.54 | 1Score > 44 indicates identityScore > 19 indicates homology |
MGGLL + Oxidation (M) | |
| 682.6606 | 2044.9600 | 2045.0000 | -19.6 | 0 | 9 | 0.95 | 1Score > 39 indicates identityScore > 21 indicates homology |
SNPSDIVHFLTLSNNTMR | |
| 455.2503 | 1362.7291 | 1362.7368 | -5.64 | 1 | 9 | 0.64 | 1Score > 40 indicates identityScore > 19 indicates homology |
VALRHTNAINPR + 2 Deamidated (NQ) | |
| 752.4058 | 1502.7970 | 1502.7882 | 5.91 | 0 | 9 | 0.31 | 1Score > 40 indicates identityScore > 16 indicates homology |
YVQFLTHPGATLR + Deamidated (NQ) | |
| 617.2761 | 1848.8065 | 1848.7869 | 10.6 | 1 | 9 | 0.4 | 1Score > 37 indicates identityScore > 17 indicates homology |
KMSGHMGAVQQSTQNLE + 4 Deamidated (NQ) | |
| 565.2928 | 1692.8566 | 1692.8682 | -6.89 | 1 | 9 | 0.93 | 1Score > 40 indicates identityScore > 21 indicates homology |
QLGASALAALTTRGFSE + Deamidated (NQ) | |
| 576.6642 | 1726.9708 | 1726.9505 | 11.7 | 0 | 9 | 0.51 | 1Score > 35 indicates identityScore > 18 indicates homology |
ISWADLIILTGNVALE | |
| 547.7850 | 1093.5554 | 1093.5768 | -19.5 | 1 | 9 | 0.95 | 1Score > 41 indicates identityScore > 21 indicates homology |
GIITYVGESR | |
| 427.8983 | 1280.6731 | 1280.6500 | 18.0 | 0 | 9 | 0.59 | 1Score > 39 indicates identityScore > 19 indicates homology |
VTDQISDIVYK + Deamidated (NQ) | |
| 465.8961 | 1394.6665 | 1394.6466 | 14.2 | 0 | 9 | 0.68 | 1Score > 41 indicates identityScore > 20 indicates homology |
WQSLLNFNSQR + 3 Deamidated (NQ) | |
| 1122.1067 | 2242.1988 | 2242.1998 | -0.41 | 1 | 9 | 0.5 | 1Score > 36 indicates identityScore > 18 indicates homology |
VLPNGSLFLPAVGIQDEGIFR + Deamidated (NQ) | |
| 875.4686 | 1748.9226 | 1748.8992 | 13.4 | 1 | 9 | 0.38 | 1Score > 39 indicates identityScore > 17 indicates homology |
NLRADNAFMLLTQAR + Oxidation (M) | |
| 512.9841 | 1535.9305 | 1535.9115 | 12.3 | 0 | 9 | 0.81 | 1Score > 29 indicates identityScore > 20 indicates homology |
VFLLALIWAYISK | |
| 872.4576 | 871.4503 | 871.4651 | -16.9 | 1 | 9 | 0.34 | 1Score > 41 indicates identityScore > 16 indicates homology |
APVLNKTE + Deamidated (NQ) | |
| 909.8254 | 2726.4544 | 2726.4023 | 19.1 | 1 | 9 | 0.19 | 1Score > 35 indicates identityScore > 14 indicates homology |
FIKPLDQNMILEMAGSHDLLVTLE | |
| 857.4882 | 1712.9618 | 1712.9533 | 4.98 | 1 | 9 | 0.47 | 1Score > 36 indicates identityScore > 18 indicates homology |
RSGIGLLGNSIDVLSGR | |
| 576.0095 | 1725.0067 | 1724.9785 | 16.3 | 1 | 9 | 0.23 | 1Score > 31 indicates identityScore > 15 indicates homology |
VGLKLDQAGLDVLGTAR | |
| 792.3981 | 1582.7816 | 1582.7549 | 16.9 | 0 | 9 | 0.95 | 1Score > 40 indicates identityScore > 21 indicates homology |
TLNQAMFLSSVLDE + Oxidation (M) | |
| 889.4735 | 1776.9324 | 1776.9040 | 16.0 | 0 | 9 | 0.73 | 1Score > 39 indicates identityScore > 20 indicates homology |
DASLVAVSTGLLQNMSR + Oxidation (M) | |
| 475.9765 | 1899.8769 | 1899.8924 | -8.17 | 1 | 9 | 0.43 | 1Score > 39 indicates identityScore > 17 indicates homology |
LANFDMSAFVDNAIKVE + Deamidated (NQ); Oxidation (M) | |
| 767.7502 | 2300.2288 | 2300.2488 | -8.72 | 1 | 9 | 0.26 | 1Score > 36 indicates identityScore > 15 indicates homology |
GEITGSTAGLAPGHVQANLAVLPK | |
| 327.1916 | 978.5530 | 978.5386 | 14.7 | 1 | 9 | 0.96 | 1Score > 38 indicates identityScore > 21 indicates homology |
KIDLSQFK + Deamidated (NQ) | |
| 778.8528 | 1555.6910 | 1555.7075 | -10.6 | 1 | 9 | 0.53 | 1Score > 39 indicates identityScore > 18 indicates homology |
NAILNSDFQKQMK + 4 Deamidated (NQ); Oxidation (M) | |
| 578.9669 | 1733.8789 | 1733.8584 | 11.8 | 1 | 9 | 0.59 | 1Score > 40 indicates identityScore > 19 indicates homology |
LNGSAVDFDVNDKALR + Deamidated (NQ) | |
| 683.8592 | 1365.7038 | 1365.7292 | -18.6 | 0 | 9 | 0.68 | 1Score > 40 indicates identityScore > 19 indicates homology |
IAAQDYIIGVFR + Deamidated (NQ) | |
| 723.3613 | 722.3540 | 722.3520 | 2.75 | 0 | 9 | 0.41 | 1Score > 41 indicates identityScore > 17 indicates homology |
TITMIE + Oxidation (M) | |
| 633.8800 | 1265.7454 | 1265.7343 | 8.80 | 1 | 9 | 0.85 | 1Score > 34 indicates identityScore > 20 indicates homology |
LQLQELGPVIR + Deamidated (NQ) | |
| 732.3901 | 1462.7656 | 1462.7780 | -8.44 | 1 | 9 | 0.84 | 1Score > 40 indicates identityScore > 20 indicates homology |
IAETGFGTIATLGGR | |
| 686.3360 | 2055.9862 | 2056.0193 | -16.1 | 1 | 9 | 0.78 | 1Score > 40 indicates identityScore > 20 indicates homology |
MAGHMGAARVTTQNLQIVR + 3 Deamidated (NQ) | |
| 1043.5287 | 2085.0428 | 2085.0466 | -1.79 | 1 | 9 | 0.79 | 1Score > 39 indicates identityScore > 20 indicates homology |
YHGLSVGVILNTMHPFER + Oxidation (M) | |
| 456.2300 | 1365.6682 | 1365.6565 | 8.57 | 1 | 9 | 0.82 | 1Score > 41 indicates identityScore > 20 indicates homology |
VGRVFGYNNLPE + 2 Deamidated (NQ) | |
| 946.4820 | 1890.9494 | 1890.9548 | -2.82 | 1 | 9 | 0.78 | 1Score > 40 indicates identityScore > 20 indicates homology |
QQGTGAVAHIQLAGESAPR + Deamidated (NQ) | |
| 580.3598 | 1158.7050 | 1158.6860 | 16.5 | 0 | 9 | 0.88 | 1Score > 31 indicates identityScore > 20 indicates homology |
ILDTVISSIAK | |
| 469.5205 | 1874.0529 | 1874.0262 | 14.3 | 1 | 9 | 0.63 | 1Score > 33 indicates identityScore > 19 indicates homology |
IRTNPTISLDLDFITR | |
| 629.3148 | 2513.2301 | 2513.2696 | -15.7 | 1 | 9 | 0.55 | 1Score > 39 indicates identityScore > 18 indicates homology |
LVVSHLACADTPEHPLNATQLAR + Deamidated (NQ) | |
| 557.2607 | 1112.5068 | 1112.4882 | 16.8 | 1 | 9 | 0.84 | 1Score > 39 indicates identityScore > 20 indicates homology |
LEFLMGQME + Oxidation (M) | |
| 694.8250 | 1387.6354 | 1387.6255 | 7.14 | 0 | 9 | 0.24 | 1Score > 40 indicates identityScore > 15 indicates homology |
ADAIAIHFNSAQE + 2 Deamidated (NQ) | |
| 659.0160 | 1974.0262 | 1973.9946 | 16.0 | 1 | 9 | 0.51 | 1Score > 39 indicates identityScore > 18 indicates homology |
TEPITPEIVAQHGLKPDE + Deamidated (NQ) | |
| 512.0315 | 2044.0969 | 2044.0589 | 18.6 | 1 | 9 | 0.63 | 1Score > 37 indicates identityScore > 19 indicates homology |
SPVPTNIRHIQEPSNIIE + Deamidated (NQ) | |
| 780.7188 | 2339.1346 | 2339.1514 | -7.21 | 1 | 8 | 0.55 | 1Score > 39 indicates identityScore > 18 indicates homology |
SPMLASRAGWIHTPLDVDAMR + Oxidation (M) | |
| 532.2825 | 531.2752 | 531.2653 | 18.8 | 1 | 8 | 0.79 | 1Score > 47 indicates identityScore > 20 indicates homology |
AGKAGE | |
| 509.7801 | 1017.5456 | 1017.5528 | -7.07 | 1 | 8 | 0.26 | 1Score > 41 indicates identityScore > 15 indicates homology |
KILVDGNMK + Deamidated (NQ) | |
| 1078.5751 | 1077.5678 | 1077.5567 | 10.4 | 0 | 8 | 1 | 1Score > 41 indicates identityScore > 21 indicates homology |
KPLQNSHPR + 2 Deamidated (NQ) | |
| 686.3741 | 2056.1005 | 2056.0742 | 12.8 | 1 | 8 | 0.54 | 1Score > 37 indicates identityScore > 18 indicates homology |
TGVNNAFGKNLIGLFHQPK + 2 Deamidated (NQ) | |
| 579.3239 | 1156.6332 | 1156.6452 | -10.3 | 0 | 8 | 0.88 | 1Score > 40 indicates identityScore > 20 indicates homology |
QGINTIPISSK | |
| 357.7000 | 713.3854 | 713.3748 | 14.9 | 0 | 8 | 0.64 | 1Score > 38 indicates identityScore > 19 indicates homology |
TVFYGK | |
| 439.2635 | 876.5124 | 876.5102 | 2.52 | 1 | 8 | 0.85 | 1Score > 38 indicates identityScore > 20 indicates homology |
AMAILKSK + Oxidation (M) | |
| 1074.5527 | 1073.5454 | 1073.5604 | -14.0 | 1 | 8 | 0.42 | 1Score > 42 indicates identityScore > 17 indicates homology |
QQESLNLLK + 2 Deamidated (NQ) | |
| 752.3959 | 1502.7772 | 1502.7828 | -3.67 | 1 | 8 | 0.98 | 1Score > 41 indicates identityScore > 21 indicates homology |
ANLTNTSIVKALQE + 2 Deamidated (NQ) | |
| 904.9907 | 1807.9668 | 1807.9502 | 9.20 | 1 | 8 | 0.6 | 1Score > 38 indicates identityScore > 19 indicates homology |
VMGLDATALSYGDLVKR | |
| 832.7456 | 2495.2150 | 2495.2254 | -4.17 | 1 | 8 | 0.62 | 1Score > 38 indicates identityScore > 19 indicates homology |
AGANVVFVDENIFPQTLAVMTTR + 3 Deamidated (NQ) | |
| 947.5014 | 1892.9882 | 1892.9731 | 8.01 | 1 | 8 | 0.67 | 1Score > 39 indicates identityScore > 19 indicates homology |
NFNVSVNILQGKISQTK + 4 Deamidated (NQ) | |
| 860.0729 | 2577.1969 | 2577.1727 | 9.39 | 1 | 8 | 0.27 | 1Score > 37 indicates identityScore > 15 indicates homology |
MPQGFQVVAETANAPVCAIQDTAR + 4 Deamidated (NQ) | |
| 667.0024 | 1997.9854 | 1997.9953 | -4.95 | 1 | 8 | 0.81 | 1Score > 40 indicates identityScore > 20 indicates homology |
MTTAAQVSGLDVAPTRHAR + Deamidated (NQ); Oxidation (M) | |
| 799.4078 | 1596.8010 | 1596.8181 | -10.7 | 1 | 8 | 0.93 | 1Score > 40 indicates identityScore > 21 indicates homology |
LDGKNMIHGIILQE + Deamidated (NQ); Oxidation (M) | |
| 861.4258 | 1720.8370 | 1720.8441 | -4.07 | 1 | 8 | 0.99 | 1Score > 41 indicates identityScore > 21 indicates homology |
MELILNSLISDDLTE + Oxidation (M) | |
| 986.5027 | 1970.9908 | 1970.9659 | 12.7 | 0 | 8 | 0.78 | 1Score > 39 indicates identityScore > 20 indicates homology |
IGQMAQQPAAFIPDAALVE + 2 Deamidated (NQ) | |
| 804.4351 | 3213.7113 | 3213.6674 | 13.7 | 1 | 8 | 0.3 | 1Score > 33 indicates identityScore > 16 indicates homology |
LIIFRGLQGIGGGIMMPMAMIVIGDLFTGK + Deamidated (NQ); 4 Oxidation (M) | |
| 351.9373 | 1403.7201 | 1403.7409 | -14.8 | 0 | 8 | 0.97 | 1Score > 41 indicates identityScore > 21 indicates homology |
IHTISDLLSYSR | |
| 604.6699 | 1810.9879 | 1811.0152 | -15.1 | 1 | 8 | 0.83 | 1Score > 37 indicates identityScore > 20 indicates homology |
TLDRGLAILNDAVAQLK + Deamidated (NQ) | |
| 747.0291 | 2238.0655 | 2238.0376 | 12.5 | 0 | 8 | 0.78 | 1Score > 39 indicates identityScore > 20 indicates homology |
GHGNLMAHVDLFVPTDLDDR + Deamidated (NQ); Oxidation (M) | |
| 826.4331 | 1650.8516 | 1650.8399 | 7.10 | 1 | 8 | 0.74 | 1Score > 40 indicates identityScore > 20 indicates homology |
MIQAGLRIDVDTFR + Deamidated (NQ); Oxidation (M) | |
| 536.3285 | 1070.6424 | 1070.6488 | -5.92 | 1 | 8 | 0.86 | 1Score > 36 indicates identityScore > 20 indicates homology |
IPFLLEALR | |
| 589.0004 | 1763.9794 | 1763.9781 | 0.70 | 1 | 8 | 0.57 | 1Score > 35 indicates identityScore > 18 indicates homology |
NIVHGQLITAITLDEK |
Not what you expected? Try
the select summary.