| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | Rita1 sp |
| MS data file | : | PRT1270_T-BRSC_1_20250714114344.mgf |
| Database | : | SwissProt 57.15 (515,203 sequences; 181,334,896 residues) |
| Timestamp | : | 12 Aug 2025 at 22:50:29 GMT |
Not what you expected? Try
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | GluC_Trypsin |
| Fixed modifications | : | |
| Variable modifications | : | |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,938 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 | 2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | ||||
| 6.2e-007 | 1 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | ||||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle (
) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 520.2880 | 1557.8422 | 1557.8362 | 3.81 | 1 | 10 | 0.31 | 1Score > 39 indicates identityScore > 18 indicates homology |
AIVTNVAGTTRDIVE | |
| 343.1937 | 1026.5593 | 1026.5498 | 9.19 | 1 | 10 | 0.89 | 1Score > 38 indicates identityScore > 22 indicates homology |
RVYDTFVK | |
| 944.9387 | 1887.8628 | 1887.8713 | -4.47 | 1 | 10 | 0.38 | 1Score > 39 indicates identityScore > 19 indicates homology |
DVYEPFLMQEGFLQR + Deamidated (NQ); Oxidation (M) | |
| 947.9982 | 1893.9818 | 1893.9571 | 13.1 | 1 | 10 | 0.59 | 1Score > 39 indicates identityScore > 21 indicates homology |
NFNVSVNILQGKISQTK + 5 Deamidated (NQ) | |
| 1051.0123 | 2100.0100 | 2100.0415 | -15.0 | 1 | 10 | 0.53 | 1Score > 39 indicates identityScore > 20 indicates homology |
LLSQPFNSSTPVLYYNKE + Deamidated (NQ) | |
| 722.4116 | 721.4043 | 721.4010 | 4.56 | 0 | 10 | 0.25 | 1Score > 40 indicates identityScore > 17 indicates homology |
DFSILK | |
| 922.9487 | 1843.8828 | 1843.8873 | -2.42 | 1 | 10 | 0.7 | 1Score > 40 indicates identityScore > 21 indicates homology |
GAQQTLPMGPVASQEAIK + 3 Deamidated (NQ); Oxidation (M) | |
| 558.3082 | 1114.6018 | 1114.6234 | -19.3 | 1 | 10 | 0.73 | 1Score > 41 indicates identityScore > 22 indicates homology |
AGIVLQGTEVK + Deamidated (NQ) | |
| 581.9999 | 1742.9779 | 1742.9567 | 12.2 | 1 | 10 | 0.88 | 1Score > 35 indicates identityScore > 22 indicates homology |
ALAEGLADIPPVPEPVR | |
| 638.9900 | 1913.9482 | 1913.9516 | -1.81 | 0 | 10 | 0.55 | 1Score > 40 indicates identityScore > 20 indicates homology |
LLGDDNLAGQADQAAMLAK | |
| 781.4296 | 1560.8446 | 1560.8334 | 7.22 | 1 | 10 | 0.94 | 1Score > 39 indicates identityScore > 23 indicates homology |
GELGQPLMPHIQLK + Deamidated (NQ) | |
| 358.5161 | 1072.5265 | 1072.5090 | 16.3 | 1 | 10 | 0.68 | 1Score > 41 indicates identityScore > 21 indicates homology |
EWFQGHLR + Deamidated (NQ) | |
| 460.6004 | 1378.7794 | 1378.7569 | 16.3 | 0 | 10 | 0.6 | 1Score > 35 indicates identityScore > 21 indicates homology |
GQPLGPAGVQVSLR + Deamidated (NQ) | |
| 687.3608 | 2059.0606 | 2059.0925 | -15.5 | 1 | 10 | 0.58 | 1Score > 39 indicates identityScore > 21 indicates homology |
ATPFITMLNALHSEVFLR | |
| 638.3214 | 1274.6282 | 1274.6401 | -9.30 | 1 | 10 | 0.93 | 1Score > 41 indicates identityScore > 23 indicates homology |
LRSVMNTSDPR | |
| 481.2459 | 1440.7159 | 1440.7222 | -4.40 | 1 | 10 | 0.86 | 1Score > 40 indicates identityScore > 22 indicates homology |
QDHRVQDFLQR | |
| 670.0615 | 2007.1627 | 2007.1364 | 13.1 | 1 | 10 | 1 | 1Score > 29 indicates identityScore > 23 indicates homology |
DDLLIQALTVAVQVPQRK + Deamidated (NQ) | |
| 938.7889 | 2813.3449 | 2813.3793 | -12.2 | 0 | 10 | 0.25 | 1Score > 37 indicates identityScore > 17 indicates homology |
LHLALDGGDNLAYIAPTMVNLNLTQE + 2 Deamidated (NQ); Oxidation (M) | |
| 775.4000 | 2323.1782 | 2323.1478 | 13.1 | 0 | 10 | 0.63 | 1Score > 38 indicates identityScore > 21 indicates homology |
MAQVINTNYLSLVTQNNLNR + 2 Deamidated (NQ); Oxidation (M) | |
| 902.4700 | 1802.9254 | 1802.9059 | 10.8 | 1 | 10 | 0.31 | 1Score > 40 indicates identityScore > 18 indicates homology |
VDVYLCGPVPMVEAVR | |
| 1012.5238 | 2023.0330 | 2023.0633 | -14.9 | 1 | 10 | 0.53 | 1Score > 39 indicates identityScore > 20 indicates homology |
LSMAGNHLASLPIDLGRSR + Oxidation (M) | |
| 693.8616 | 1385.7086 | 1385.6973 | 8.21 | 0 | 10 | 0.99 | 1Score > 41 indicates identityScore > 23 indicates homology |
MAPALSGANLTSPR + Deamidated (NQ) | |
| 579.3297 | 578.3224 | 578.3176 | 8.27 | 0 | 10 | 0.94 | 1Score > 40 indicates identityScore > 23 indicates homology |
FGSIR | |
| 1005.9938 | 2009.9730 | 2010.0092 | -18.0 | 0 | 10 | 0.95 | 1Score > 40 indicates identityScore > 23 indicates homology |
IFTALSTINNMGQNGTTVK + Deamidated (NQ) | |
| 408.7238 | 1630.8661 | 1630.8678 | -1.06 | 0 | 10 | 0.53 | 1Score > 39 indicates identityScore > 20 indicates homology |
INDGVAIALYGLNAAR + Deamidated (NQ) | |
| 351.9373 | 1403.7201 | 1403.7007 | 13.9 | 1 | 10 | 0.9 | 1Score > 41 indicates identityScore > 22 indicates homology |
VSMELVWSPVLE + Oxidation (M) | |
| 1012.5280 | 2023.0414 | 2023.0698 | -14.0 | 1 | 10 | 0.24 | 1Score > 39 indicates identityScore > 17 indicates homology |
SAALQSIQENLGLQDAPLR | |
| 752.3904 | 1502.7662 | 1502.7477 | 12.3 | 1 | 10 | 0.92 | 1Score > 41 indicates identityScore > 22 indicates homology |
NSIHSIYTELNGR | |
| 421.7237 | 841.4328 | 841.4294 | 4.15 | 1 | 10 | 0.89 | 1Score > 38 indicates identityScore > 22 indicates homology |
QIAQPER + Deamidated (NQ) | |
| 714.7171 | 2141.1295 | 2141.1303 | -0.37 | 1 | 10 | 0.54 | 1Score > 37 indicates identityScore > 20 indicates homology |
LHQLAGYKQILTPQLMNR + 2 Deamidated (NQ); Oxidation (M) | |
| 418.2336 | 834.4526 | 834.4633 | -12.8 | 1 | 10 | 0.29 | 1Score > 40 indicates identityScore > 17 indicates homology |
TSLAGMKK | |
| 934.5584 | 1867.1022 | 1867.0971 | 2.75 | 0 | 10 | 0.45 | 1Score > 28 indicates identityScore > 19 indicates homology |
GVISFYLIGQLLYLIR | |
| 679.3931 | 2035.1575 | 2035.1605 | -1.48 | 1 | 10 | 0.38 | 1Score > 31 indicates identityScore > 18 indicates homology |
VQLVLPLLVAEAAAAPAFLE + Deamidated (NQ) | |
| 379.2094 | 1512.8085 | 1512.8300 | -14.2 | 0 | 10 | 0.54 | 1Score > 39 indicates identityScore > 20 indicates homology |
EPQRPFLAILGGSK + Deamidated (NQ) | |
| 741.9416 | 1481.8686 | 1481.8540 | 9.85 | 1 | 10 | 0.22 | 1Score > 33 indicates identityScore > 16 indicates homology |
MLFPSIIAGLKHR | |
| 488.5084 | 1950.0045 | 1949.9768 | 14.2 | 1 | 10 | 0.37 | 1Score > 39 indicates identityScore > 18 indicates homology |
GNDLSMYIVLPKDNNIK + Deamidated (NQ); Oxidation (M) | |
| 739.3644 | 2215.0714 | 2215.0878 | -7.41 | 0 | 10 | 0.82 | 1Score > 39 indicates identityScore > 22 indicates homology |
FNAPLAHQMMAGADVLAVTSR + Oxidation (M) | |
| 998.4910 | 2992.4512 | 2992.4263 | 8.30 | 0 | 10 | 1 | 1Score > 37 indicates identityScore > 23 indicates homology |
LWDVSTLVANDTIPTPAPLTDLDYSME + Oxidation (M) | |
| 562.6334 | 1684.8784 | 1684.9108 | -19.2 | 1 | 10 | 0.75 | 1Score > 40 indicates identityScore > 21 indicates homology |
QADVLLVRSVTNVNR + 2 Deamidated (NQ) | |
| 471.2573 | 1410.7501 | 1410.7368 | 9.42 | 1 | 10 | 0.98 | 1Score > 39 indicates identityScore > 23 indicates homology |
EPSIQSPVWRGR | |
| 624.6476 | 1870.9210 | 1870.9247 | -2.01 | 0 | 10 | 0.9 | 1Score > 40 indicates identityScore > 22 indicates homology |
SVFGMIAAASSIVDFNAR + Oxidation (M) | |
| 1081.0688 | 2160.1230 | 2160.0851 | 17.6 | 0 | 10 | 0.58 | 1Score > 38 indicates identityScore > 20 indicates homology |
INIYPADIQQWITQQTAR + 2 Deamidated (NQ) | |
| 712.8615 | 1423.7084 | 1423.7096 | -0.78 | 0 | 10 | 0.85 | 1Score > 41 indicates identityScore > 22 indicates homology |
NQLVIYHGIHTE + Deamidated (NQ) | |
| 1070.0190 | 2138.0234 | 2137.9950 | 13.3 | 1 | 10 | 0.23 | 1Score > 39 indicates identityScore > 16 indicates homology |
ISGSGQVHPNVLRNMGLDPE + 3 Deamidated (NQ); Oxidation (M) | |
| 712.8318 | 1423.6490 | 1423.6290 | 14.1 | 0 | 10 | 0.74 | 1Score > 40 indicates identityScore > 21 indicates homology |
SADANFVPTMQVE + Oxidation (M) | |
| 693.7076 | 2078.1010 | 2078.0632 | 18.2 | 1 | 10 | 0.94 | 1Score > 37 indicates identityScore > 22 indicates homology |
ALTRLCALWHQPAAWQR + Deamidated (NQ) | |
| 1012.5338 | 2023.0530 | 2023.0698 | -8.27 | 1 | 10 | 0.71 | 1Score > 38 indicates identityScore > 21 indicates homology |
SAALQSIQENLGLQDAPLR | |
| 906.7488 | 3622.9661 | 3622.9235 | 11.8 | 1 | 10 | 0.12 | 1Score > 30 indicates identityScore > 13 indicates homology |
IFKMAPLHHHFQKPGNAGIQALIQKPFNVVPE + Deamidated (NQ); Oxidation (M) | |
| 834.4506 | 833.4433 | 833.4429 | 0.49 | 1 | 10 | 0.82 | 1Score > 42 indicates identityScore > 22 indicates homology |
KADMVVR + Oxidation (M) | |
| 481.2476 | 1440.7210 | 1440.7321 | -7.70 | 1 | 10 | 0.76 | 1Score > 40 indicates identityScore > 21 indicates homology |
VQIVNNNNGARIE + Deamidated (NQ) | |
| 772.4117 | 1542.8088 | 1542.7963 | 8.12 | 1 | 10 | 0.96 | 1Score > 40 indicates identityScore > 22 indicates homology |
IANVDVTIICEAPK + Deamidated (NQ) | |
| 746.3849 | 2236.1329 | 2236.1535 | -9.22 | 1 | 10 | 0.17 | 1Score > 39 indicates identityScore > 15 indicates homology |
IHQDGIHILVNMNGYTKGAR | |
| 658.8648 | 2631.4301 | 2631.3980 | 12.2 | 1 | 10 | 0.21 | 1Score > 33 indicates identityScore > 16 indicates homology |
GDNIVAADLGVLIQNSAKHVQGNVAK + Deamidated (NQ) | |
| 529.9625 | 1586.8657 | 1586.8668 | -0.71 | 1 | 10 | 0.33 | 1Score > 38 indicates identityScore > 18 indicates homology |
LSSEAVSVLWDLLR | |
| 449.7603 | 897.5060 | 897.5144 | -9.33 | 1 | 10 | 0.74 | 1Score > 38 indicates identityScore > 21 indicates homology |
APNARLTR | |
| 806.9328 | 1611.8510 | 1611.8508 | 0.14 | 1 | 10 | 0.78 | 1Score > 39 indicates identityScore > 21 indicates homology |
EQVPQGYVAPAQVLI + Deamidated (NQ) | |
| 834.4680 | 1666.9214 | 1666.9083 | 7.90 | 0 | 10 | 0.29 | 1Score > 37 indicates identityScore > 17 indicates homology |
LLINGGTISPFFFNK | |
| 862.9851 | 1723.9556 | 1723.9369 | 10.9 | 1 | 10 | 0.73 | 1Score > 36 indicates identityScore > 21 indicates homology |
VLISYYLRNSNNLR | |
| 365.2110 | 728.4074 | 728.4181 | -14.6 | 0 | 10 | 0.84 | 1Score > 42 indicates identityScore > 22 indicates homology |
VTGTPVR | |
| 846.3784 | 1690.7422 | 1690.7475 | -3.08 | 1 | 10 | 0.44 | 1Score > 38 indicates identityScore > 19 indicates homology |
QLAEYDIYAGQPHGE + Deamidated (NQ) | |
| 597.0279 | 1788.0619 | 1788.0873 | -14.2 | 1 | 10 | 0.37 | 1Score > 27 indicates identityScore > 18 indicates homology |
LVGLKQLPDTLTLHLK | |
| 1068.5619 | 2135.1092 | 2135.0858 | 11.0 | 1 | 10 | 0.33 | 1Score > 38 indicates identityScore > 18 indicates homology |
ILLSLDNQDLEINQVNHR + 2 Deamidated (NQ) | |
| 783.9034 | 1565.7922 | 1565.7838 | 5.42 | 1 | 10 | 0.49 | 1Score > 41 indicates identityScore > 19 indicates homology |
YAGHQLQQIIEHK + 2 Deamidated (NQ) | |
| 696.6760 | 2087.0062 | 2086.9656 | 19.4 | 1 | 10 | 0.54 | 1Score > 39 indicates identityScore > 20 indicates homology |
ALDTYNEINAVMNLVLFE + 3 Deamidated (NQ); Oxidation (M) | |
| 714.6862 | 2141.0368 | 2140.9986 | 17.8 | 0 | 10 | 0.8 | 1Score > 39 indicates identityScore > 21 indicates homology |
NFMAQYQATQQISPIIQR + 5 Deamidated (NQ) | |
| 362.2429 | 722.4712 | 722.4691 | 3.04 | 0 | 10 | 0.64 | 1Score > 25 indicates identityScore > 21 indicates homology |
LPVPLGK | |
| 321.9276 | 1283.6813 | 1283.6833 | -1.59 | 0 | 10 | 0.85 | 1Score > 40 indicates identityScore > 22 indicates homology |
AQTGISLLNNPR + Deamidated (NQ) | |
| 400.7000 | 799.3854 | 799.3712 | 17.8 | 0 | 10 | 0.55 | 1Score > 39 indicates identityScore > 20 indicates homology |
QAGVAQPE + Deamidated (NQ) | |
| 572.3004 | 1142.5862 | 1142.5931 | -6.02 | 1 | 10 | 0.43 | 1Score > 41 indicates identityScore > 19 indicates homology |
EVLDAIDAAAR | |
| 597.3418 | 596.3345 | 596.3282 | 10.6 | 0 | 10 | 0.27 | 1Score > 37 indicates identityScore > 17 indicates homology |
EPPVR | |
| 1108.5664 | 2215.1182 | 2215.1082 | 4.54 | 1 | 10 | 0.15 | 1Score > 39 indicates identityScore > 14 indicates homology |
DLYLHQLLISQGLAKMEPE + 2 Deamidated (NQ); Oxidation (M) | |
| 915.5262 | 914.5189 | 914.5259 | -7.64 | 0 | 10 | 0.93 | 1Score > 42 indicates identityScore > 22 indicates homology |
VTPLLMNK | |
| 376.2018 | 1125.5836 | 1125.5778 | 5.11 | 0 | 10 | 0.84 | 1Score > 39 indicates identityScore > 22 indicates homology |
QHQLAVSSVR + 2 Deamidated (NQ) | |
| 944.5060 | 1886.9974 | 1887.0102 | -6.74 | 1 | 10 | 0.82 | 1Score > 38 indicates identityScore > 22 indicates homology |
FGRLVQLQTLILQDNE + Deamidated (NQ) | |
| 550.2752 | 2197.0717 | 2197.0386 | 15.1 | 1 | 10 | 0.68 | 1Score > 39 indicates identityScore > 21 indicates homology |
SSRNASISNGTSISDTIFPIE + 2 Deamidated (NQ) | |
| 998.4958 | 2992.4656 | 2992.5150 | -16.5 | 0 | 10 | 0.25 | 1Score > 37 indicates identityScore > 16 indicates homology |
ALCAQTMLVSHPGVNVLLLDDGLQHYK + Deamidated (NQ) | |
| 509.6464 | 2543.1956 | 2543.2425 | -18.4 | 1 | 10 | 0.31 | 1Score > 38 indicates identityScore > 17 indicates homology |
GQTLQCSSYTTTPIKSTLSINNK + 2 Deamidated (NQ) | |
| 882.7784 | 2645.3134 | 2645.2652 | 18.2 | 1 | 10 | 0.27 | 1Score > 38 indicates identityScore > 17 indicates homology |
DCVMLLMDGLLNFSKSYLPNQR + 2 Oxidation (M) | |
| 978.5389 | 1955.0632 | 1955.0663 | -1.54 | 0 | 10 | 0.47 | 1Score > 36 indicates identityScore > 19 indicates homology |
NLMSTHSLGIVFGPTLLR | |
| 353.5281 | 1057.5625 | 1057.5478 | 13.9 | 0 | 10 | 0.92 | 1Score > 41 indicates identityScore > 22 indicates homology |
VLPGGLMQVE + Oxidation (M) | |
| 552.2914 | 2205.1365 | 2205.0947 | 19.0 | 1 | 10 | 0.68 | 1Score > 38 indicates identityScore > 21 indicates homology |
RMSALDLSSNPSTPSTVSQVK + Deamidated (NQ) | |
| 563.0341 | 2248.1073 | 2248.0980 | 4.13 | 0 | 10 | 0.75 | 1Score > 39 indicates identityScore > 21 indicates homology |
GLMVLNQDDPLVAAMYRPGR + Deamidated (NQ); 2 Oxidation (M) | |
| 772.7207 | 2315.1403 | 2315.1065 | 14.6 | 1 | 10 | 0.27 | 1Score > 39 indicates identityScore > 17 indicates homology |
MNNYETVFILTPVLSDAQMK + 2 Deamidated (NQ) | |
| 657.6888 | 1970.0446 | 1970.0724 | -14.1 | 1 | 10 | 0.7 | 1Score > 38 indicates identityScore > 21 indicates homology |
LAAFLIGGISIADLPEGQGK + Deamidated (NQ) | |
| 606.9970 | 1817.9692 | 1817.9557 | 7.40 | 0 | 10 | 0.78 | 1Score > 38 indicates identityScore > 21 indicates homology |
TIVVNGDVDLSTGILMR + Oxidation (M) | |
| 946.5106 | 1891.0066 | 1891.0050 | 0.85 | 1 | 10 | 0.52 | 1Score > 38 indicates identityScore > 19 indicates homology |
SIRNALYNGITADQIIK + 2 Deamidated (NQ) | |
| 877.4423 | 1752.8700 | 1752.8782 | -4.63 | 1 | 10 | 0.79 | 1Score > 40 indicates identityScore > 21 indicates homology |
QLKSYTTIVADTGDIE | |
| 670.7072 | 2009.0998 | 2009.1381 | -19.1 | 1 | 10 | 0.98 | 1Score > 36 indicates identityScore > 22 indicates homology |
TSLGTINHSLLSLAALRSR | |
| 414.8913 | 1241.6521 | 1241.6615 | -7.62 | 0 | 10 | 0.96 | 1Score > 40 indicates identityScore > 22 indicates homology |
NSTPQLAGILAR + 2 Deamidated (NQ) | |
| 784.9388 | 1567.8630 | 1567.8359 | 17.3 | 1 | 10 | 0.98 | 1Score > 37 indicates identityScore > 22 indicates homology |
VGGQVLPGFTKVTHE | |
| 617.6552 | 1849.9438 | 1849.9356 | 4.41 | 1 | 10 | 0.56 | 1Score > 40 indicates identityScore > 20 indicates homology |
LMATNAADIFGLQQKGR + Deamidated (NQ); Oxidation (M) | |
| 682.3596 | 2044.0570 | 2044.0854 | -13.9 | 1 | 10 | 0.6 | 1Score > 38 indicates identityScore > 20 indicates homology |
LALPFGIALHHAGLTENDR | |
| 696.6758 | 2087.0056 | 2086.9695 | 17.3 | 1 | 10 | 0.36 | 1Score > 39 indicates identityScore > 18 indicates homology |
LNPNTGVENLTPDFSNKPE + 2 Deamidated (NQ) | |
| 802.9603 | 1603.9060 | 1603.8855 | 12.8 | 1 | 10 | 0.36 | 1Score > 35 indicates identityScore > 18 indicates homology |
DAAILLKSMASLDLK + Oxidation (M) | |
| 775.7219 | 2324.1439 | 2324.1035 | 17.4 | 1 | 10 | 0.44 | 1Score > 39 indicates identityScore > 19 indicates homology |
RNAMGASNAMIAADMALAGITSR + 2 Oxidation (M) | |
| 671.0174 | 2010.0304 | 2010.0633 | -16.4 | 1 | 10 | 0.84 | 1Score > 39 indicates identityScore > 21 indicates homology |
GQIVDTVVQEQRPSVLLE + Deamidated (NQ) | |
| 1012.5250 | 2023.0354 | 2023.0078 | 13.7 | 1 | 10 | 0.23 | 1Score > 39 indicates identityScore > 16 indicates homology |
TVRSMVNAMALDLIAQTR + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 911.7847 | 2732.3323 | 2732.3071 | 9.22 | 1 | 10 | 0.35 | 1Score > 38 indicates identityScore > 18 indicates homology |
MVMPGDNTNISVKLIQPVAMDDGLR + 3 Deamidated (NQ); Oxidation (M) | |
| 974.4760 | 2920.4062 | 2920.4429 | -12.6 | 1 | 10 | 0.2 | 1Score > 37 indicates identityScore > 15 indicates homology |
LCLRPSSSVFLGDQQLYFTQEYLR + Deamidated (NQ) | |
| 394.9008 | 1181.6806 | 1181.6880 | -6.33 | 1 | 10 | 0.58 | 1Score > 36 indicates identityScore > 20 indicates homology |
KGVQIQLPSGR |
Not what you expected? Try
the select summary.