MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | Rita1 sp |
| MS data file | : | PRT1270_T-BRSC_1_20250714114344.mgf |
| Database | : | SwissProt 57.15 (515,203 sequences; 181,334,896 residues) |
| Timestamp | : | 12 Aug 2025 at 22:50:29 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | GluC_Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,938 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
1| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | ATPB_PSEPG | 1648 | ATP synthase subunit beta OS=Pseudomonas putida (strain GB-1) GN=atpD PE=3 SV=1 | |
| 2 | ATPB_LEGPA | 425 | ATP synthase subunit beta OS=Legionella pneumophila (strain Paris) GN=atpD PE=3 SV=1 | |
56 peptide matches (32 non-duplicate, 24 duplicate)| Query | Dupes | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | U | 1 | 2 | Peptide |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Query | Dupes | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | U | 1 | 2 | Peptide |
| 278 |
586.3677 | 585.3604 | 585.3598 | 1.01 | 0 | 25 | 1.6 | 7Score > 39 indicates identity |
|
K.QLVAR.A | |||
| 312 |
305.1848 | 608.3550 | 608.3533 | 2.79 | 0 | 16 | 0.2 | 1Score > 31 indicates identity Score > 21 indicates homology |
|
|
K.YVSLK.D | ||
| 658 |
790.3958 | 789.3885 | 789.3868 | 2.13 | 0 | 50 | 0.01 | 1Score > 43 indicates identity |
U | |
|
K.DSNVLDK.V | |
| 659 |
395.7019 | 789.3892 | 789.3868 | 3.05 | 0 | 28 | 1.6 | 2Score > 43 indicates identity |
U | |
|
K.DSNVLDK.V | |
| 1075 |
2 |
481.2794 | 960.5442 | 960.5393 | 5.16 | 0 | 65 | 0.00014 | 1Score > 39 indicates identity |
U | |
|
K.VGLFGGAGVGK.T |
| 1076 |
961.5524 | 960.5451 | 960.5393 | 6.07 | 0 | 69 | 5.8e-005 | 1Score > 39 indicates identity |
U | |
|
K.VGLFGGAGVGK.T | |
| 1079 |
962.5441 | 961.5368 | 961.5345 | 2.40 | 0 | 46 | 0.011 | 2Score > 39 indicates identity |
U | |
R.GVQYVLQR.Y | ||
| 1081 |
1 |
481.7763 | 961.5380 | 961.5345 | 3.67 | 0 | 34 | 0.08 | 1Score > 39 indicates identity Score > 35 indicates homology |
U | |
R.GVQYVLQR.Y | |
| 1361 |
553.7922 | 1105.5698 | 1105.5624 | 6.77 | 1 | 12 | 1.7 | 5Score > 42 indicates identity Score > 26 indicates homology |
U | |
|
K.TVNMMELIR.N | |
| 1401 |
1121.6271 | 1120.6198 | 1120.6128 | 6.25 | 0 | 109 | 5.8e-009 | 1Score > 39 indicates identity |
U | |
K.DTIAGFSGILK.G | ||
| 1403 |
1 |
561.3215 | 1120.6284 | 1120.6128 | 13.9 | 0 | 30 | 0.31 | 1Score > 38 indicates identity Score > 37 indicates homology |
U | |
K.DTIAGFSGILK.G | |
| 1432 |
1 |
567.3181 | 1132.6216 | 1132.6162 | 4.83 | 1 | 63 | 9.6e-005 | 1Score > 39 indicates identity Score > 35 indicates homology |
U | |
|
R.VALTGLTMAEK.F |
| 1603 |
2 |
602.8379 | 1203.6612 | 1203.6499 | 9.40 | 0 | 40 | 0.0059 | 1Score > 39 indicates identity Score > 30 indicates homology |
U | |
R.DVVPSVYNALK.V | |
| 1713 |
421.8969 | 1262.6689 | 1262.6653 | 2.85 | 1 | 46 | 0.00089 | 1Score > 41 indicates identity Score > 28 indicates homology |
U | |
R.TIAMGTTDGLKR.G | ||
| 1786 |
650.8594 | 1299.7042 | 1299.7187 | -11.1 | 1 | 11 | 52 | 9Score > 40 indicates identity |
|
E.VIGAVVDVEFPR.D | |||
| 2077 |
484.2708 | 1449.7906 | 1449.7827 | 5.41 | 1 | 61 | 2.1e-005 | 1Score > 38 indicates identity Score > 27 indicates homology |
U | |
R.YTLAGTEVSALLGR.M | ||
| 2079 |
2 |
725.9044 | 1449.7942 | 1449.7827 | 7.94 | 1 | 98 | 5.5e-009 | 1Score > 38 indicates identity Score > 28 indicates homology |
U | |
R.YTLAGTEVSALLGR.M | |
| 2391 |
533.3019 | 1596.8839 | 1596.8723 | 7.24 | 0 | 86 | 7.8e-007 | 1Score > 37 indicates identity |
U | |
R.GLDVVDTGAAISVPVGK.A | ||
| 2392 |
1 |
799.4497 | 1596.8848 | 1596.8723 | 7.85 | 0 | 102 | 1.9e-008 | 1Score > 37 indicates identity |
U | |
R.GLDVVDTGAAISVPVGK.A | |
| 2502 |
823.4151 | 1644.8156 | 1644.7930 | 13.8 | 0 | 73 | 9.1e-006 | 1Score > 41 indicates identity Score > 35 indicates homology |
U | |
K.VALVYGQMNEPPGNR.L + Deamidated (NQ) | ||
| 2559 |
6 |
834.9926 | 1667.9706 | 1667.9610 | 5.76 | 1 | 116 | 2.3e-010 | 1Score > 32 indicates identity |
U | |
R.IVQIIGAVIDVEFPR.D | |
| 2561 |
1 |
556.9987 | 1667.9743 | 1667.9610 | 7.93 | 1 | 75 | 2.8e-006 | 1Score > 32 indicates identity |
U | |
R.IVQIIGAVIDVEFPR.D | |
| 2571 |
557.3318 | 1668.9736 | 1668.9451 | 17.1 | 1 | 76 | 2.3e-006 | 1Score > 33 indicates identity |
U | |
R.IVQIIGAVIDVEFPR.D + Deamidated (NQ) | ||
| 2655 |
2 |
571.3292 | 1710.9658 | 1710.9556 | 5.94 | 1 | 53 | 0.00092 | 1Score > 35 indicates identity |
U | |
K.YVSLKDTIAGFSGILK.G | |
| 2941 |
928.9542 | 1855.8938 | 1855.8952 | -0.72 | 1 | 21 | 4.4 | 5Score > 40 indicates identity |
U | |
R.QLDPLIVGQEHYDTAR.R + 2 Deamidated (NQ) | ||
D:\Xcalibur\Data\Jennifer\PRT1270 Rita DDA\PRT1270_T-BRSC_1_20250714114344.rawScore > 40 indicates identity Score > 22 indicates homology |
|||||||||||||
| 14.8 | 1 | 18 | 0.15 | 1 | QLDPNVIGQEHYDTAR + Deamidated (NQ) | ||||||||
| 14.8 | 1 | 10 | 0.9 | 2 | QLDPNVIGQEHYDTAR + Deamidated (NQ) | ||||||||
| 14.8 | 1 | 9 | 1.2 | 3 | QLDPNVIGQEHYDTAR + Deamidated (NQ) | ||||||||
| 0.81 | 0 | 8 | 1.3 | 4 | MNLDNVAMVFAPSFLR + 2 Oxidation (M) | ||||||||
| 1.29 | 1 | 8 | 1.3 | 5 | QLDPLVIGQEHYDTAR + 2 Deamidated (NQ) | ||||||||
| 3.35 | 1 | 8 | 1.3 | 6 | MISVNDFYPGLTIELE + Oxidation (M) | ||||||||
| 13.0 | 1 | 3 | 5 | 7 | NTVYNTARVGAQSAQMK + 2 Deamidated (NQ); Oxidation (M) | ||||||||
| 2943 |
619.6398 | 1855.8976 | 1855.8952 | 1.29 | 1 | 2 | 6.3 | 8Score > 40 indicates identity Score > 22 indicates homology |
U | |
R.QLDPLIVGQEHYDTAR.R + 2 Deamidated (NQ) | ||
| -8.02 | 1 | 1 | 7.4 | 9 | LKTIYDMTASINDILE + Deamidated (NQ); Oxidation (M) | ||||||||
| -8.75 | 1 | 1 | 7.5 | 10 | FKNLVDLQIADYMDR + Oxidation (M) | ||||||||
| 3087 |
979.5160 | 1957.0174 | 1956.9986 | 9.64 | 1 | 82 | 2.7e-006 | 1Score > 39 indicates identity |
U | |
|
R.FLSQPFFVAEVFTGSPGK.Y | |
| 3089 |
2 |
653.6786 | 1958.0140 | 1957.9826 | 16.0 | 1 | 77 | 3.3e-006 | 1Score > 39 indicates identity Score > 35 indicates homology |
U | |
|
R.FLSQPFFVAEVFTGSPGK.Y + Deamidated (NQ) |
| 3090 |
1 |
980.0152 | 1958.0158 | 1957.9826 | 17.0 | 1 | 82 | 2.9e-006 | 1Score > 39 indicates identity |
U | |
|
R.FLSQPFFVAEVFTGSPGK.Y + Deamidated (NQ) |
| 3132 |
995.5179 | 1989.0212 | 1989.0055 | 7.93 | 0 | 131 | 7e-012 | 1Score > 39 indicates identity Score > 32 indicates homology |
U | |
R.DIASLGIYPAVDPLDSTSR.Q | ||
| 3857 |
2 |
813.0813 | 2436.2221 | 2436.1921 | 12.3 | 1 | 71 | 6.5e-007 | 1Score > 38 indicates identity Score > 22 indicates homology |
U | |
R.GIHQPAPSFADQAGGNDLLETGIK.V + Deamidated (NQ) | |
| 4710 |
961.9933 | 3843.9441 | 3843.9055 | 10.0 | 1 | 26 | 0.0047 | 1Score > 33 indicates identity Score > 15 indicates homology |
U | |
K.EGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSR.D + Deamidated (NQ) | ||
42 subsets and intersections (601 subset proteins in total)2| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | EFTU2_PSEPK | 1599 | Elongation factor Tu-B OS=Pseudomonas putida (strain KT2440) GN=tufB PE=3 SV=1 | |
| 5 | EFTU_MYCS5 | 42 | Elongation factor Tu OS=Mycoplasma synoviae (strain 53) GN=tuf PE=3 SV=1 | |
| 3 | EFTU_CARRP | 146 | Elongation factor Tu OS=Carsonella ruddii (strain PV) GN=tuf PE=3 SV=1 | |
| 4 | EFTU_ANATD | 54 | Elongation factor Tu OS=Anaerocellum thermophilum (strain DSM 6725 / Z-1320) GN=tuf PE=3 SV=1 | |
| 2 | EFTU1_PSEPK | 1484 | Elongation factor Tu-A OS=Pseudomonas putida (strain KT2440) GN=tufA PE=3 SV=1 | |
3| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | ATPA_PSEPK | 907 | ATP synthase subunit alpha OS=Pseudomonas putida (strain KT2440) GN=atpA PE=3 SV=1 | |
| 3 | ATPA_RICAH | 176 | ATP synthase subunit alpha OS=Rickettsia akari (strain Hartford) GN=atpA PE=3 SV=1 | |
| 2 | ATPA_VEREI | 178 | ATP synthase subunit alpha OS=Verminephrobacter eiseniae (strain EF01-2) GN=atpA PE=3 SV=1 | |
4| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | PORF_PSESY | 690 | Outer membrane porin F OS=Pseudomonas syringae pv. syringae GN=oprF PE=3 SV=1 | |
| 2 | PORF_PSEAE | 143 | Outer membrane porin F OS=Pseudomonas aeruginosa GN=oprF PE=1 SV=1 | |
5| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | RPOB_PSEPG | 513 | DNA-directed RNA polymerase subunit beta OS=Pseudomonas putida (strain GB-1) GN=rpoB PE=3 SV=1 | |
| 5 | FTSZ_PSEPK | 129 | Cell division protein ftsZ OS=Pseudomonas putida (strain KT2440) GN=ftsZ PE=3 SV=3 | |
| 2 | RPOC_PSEP1 | 418 | DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpoC PE=3 SV=1 | |
| 3 | RPOC_PSEU5 | 335 | DNA-directed RNA polymerase subunit beta' OS=Pseudomonas stutzeri (strain A1501) GN=rpoC PE=3 SV=1 | |
| 6 | RPOC_BIFLD | 91 | DNA-directed RNA polymerase subunit beta' OS=Bifidobacterium longum (strain DJO10A) GN=rpoC PE=3 SV=1 | |
| 4 | RPOC_SYNAS | 202 | DNA-directed RNA polymerase subunit beta' OS=Syntrophus aciditrophicus (strain SB) GN=rpoC PE=3 SV=1 | |
6| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | RS5_PSEE4 | 428 | 30S ribosomal protein S5 OS=Pseudomonas entomophila (strain L48) GN=rpsE PE=3 SV=1 |
7| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | RL3_PSEP1 | 378 | 50S ribosomal protein L3 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplC PE=3 SV=1 |
8| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | ARPC_PSEPU | 369 | Antibiotic efflux pump outer membrane protein arpC OS=Pseudomonas putida GN=arpC PE=2 SV=1 |
9| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | RL2_PSEP1 | 329 | 50S ribosomal protein L2 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplB PE=3 SV=1 |
10| Accession | Score | Description | ||
|---|---|---|---|---|
| 1 | DLDH2_PSEPU | 325 | Dihydrolipoamide dehydrogenase OS=Pseudomonas putida GN=lpdG PE=1 SV=4 | |
| 2 | DLDH_AZOVI | 161 | Dihydrolipoyl dehydrogenase OS=Azotobacter vinelandii PE=1 SV=1 | |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/