Rita1 sp (Mascot Search Results)

Search metadata
User	:	Jennifer
E-mail	:	[email protected]
Search title	:	Rita1 sp
MS data file	:	PRT1270_T-BRSC_1_20250714114344.mgf
Database	:	SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp	:	12 Aug 2025 at 22:50:29 GMT

Search metadata

User

Jennifer

E-mail

[email protected]

Search title

Rita1 sp

MS data file

PRT1270_T-BRSC_1_20250714114344.mgf

Database

SwissProt 57.15 (515,203 sequences; 181,334,896 residues)

Timestamp

12 Aug 2025 at 22:50:29 GMT

Search parameters
Type of search	:	MS/MS Ion Search
Enzyme	:	GluC_Trypsin
Fixed modifications	:	Carbamidomethyl (C)
Variable modifications	:	Deamidated (NQ), Oxidation (M)
Mass values	:	Monoisotopic
Protein mass	:	Unrestricted
Peptide mass tolerance	:	± 20 ppm
Fragment mass tolerance	:	± 0.1 Da
Max missed cleavages	:	1
Instrument type	:	ESI-FTICR
Number of queries	:	4,938

Search parameters

Type of search

MS/MS Ion Search

Enzyme

GluC_Trypsin

Fixed modifications

Carbamidomethyl (C)

Variable modifications

Deamidated (NQ),

Oxidation (M)

Mass values

Monoisotopic

Protein mass

Unrestricted

Peptide mass tolerance

± 20 ppm

Fragment mass tolerance

± 0.1 Da

Max missed cleavages

Instrument type

ESI-FTICR

Number of queries

4,938

Legend
Dupes	Expect	Rank	U	Peptide
	0.037	2		GAYSLSLR	significant
	9	1		GFFLFVEGGR	top ranking
	6.4e-005	1		GSSIFGLAPGK	significant and top ranking
	1.3e-006	1		SSGTSYPDVLK	peptide is found in all proteins in family member 1
	6.2e-007	1		VCNYVSWIK	peptide is found in some but not all proteins in family member 2
	6.4e-005	1	U	GSSIFGLAPGK	unique
2	5.7e-005	1		LNTLETEEWFFK	peptide has two duplicates
	0.18	1		LNTLETEEWFFK	duplicate peptide

Legend

Dupes

Expect

Rank

Peptide

0.037

GAYSLSLR

significant

GFFLFVEGGR

top ranking

6.4e-005

GSSIFGLAPGK

significant and top ranking

1.3e-006

SSGTSYPDVLK

peptide is found in all proteins in family member 1

6.2e-007

VCNYVSWIK

peptide is found in some but not all proteins in family member 2

6.4e-005

GSSIFGLAPGK

unique

5.7e-005

LNTLETEEWFFK

peptide has two duplicates

0.18

LNTLETEEWFFK

duplicate peptide

Right-facing triangle (

) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (

) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Protein families 1–10 (out of 230)

1 2 3 4 5 6 … 23 Next

1

		Accession	Score	Description
	1	ATPB_PSEPG	1648	ATP synthase subunit beta OS=Pseudomonas putida (strain GB-1) GN=atpD PE=3 SV=1
	2	ATPB_LEGPA	425	ATP synthase subunit beta OS=Legionella pneumophila (strain Paris) GN=atpD PE=3 SV=1

Cut threshold Threshold (0):

		Score	Mass	Matches	Sequences	emPAI
1.1	ATPB_PSEPG	1648	49415	52 (43)	18 (15)	1.71
	ATP synthase subunit beta OS=Pseudomonas putida (strain GB-1) GN=atpD PE=3 SV=1
	2 samesets of ATPB_PSEPG
	ATPB_PSEPK	1648	49385	52 (43)	18 (15)	1.71
	ATP synthase subunit beta OS=Pseudomonas putida (strain KT2440) GN=atpD PE=3 SV=1
	ATPB_PSEP1	1648	49385	52 (43)	18 (15)	1.71
	ATP synthase subunit beta OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=atpD PE=3 SV=1
1.2	ATPB_LEGPA	425	50052	20 (14)	9 (5)	0.43
	ATP synthase subunit beta OS=Legionella pneumophila (strain Paris) GN=atpD PE=3 SV=1
	3 samesets of ATPB_LEGPA
	ATPB_LEGPC	425	50052	20 (14)	9 (5)	0.43
	ATP synthase subunit beta OS=Legionella pneumophila (strain Corby) GN=atpD PE=3 SV=1
	ATPB_LEGPH	425	50052	20 (14)	9 (5)	0.43
	ATP synthase subunit beta OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=atpD PE=3 SV=1
	ATPB_LEGPL	425	50052	20 (14)	9 (5)	0.43
	ATP synthase subunit beta OS=Legionella pneumophila (strain Lens) GN=atpD PE=3 SV=1

56 peptide matches (32 non-duplicate, 24 duplicate)

Query	Dupes	Observed	Mr(expt)	Mr(calc)	ppm	M	Score	Expect	Rank	U	1	2	Peptide
Query	Dupes	Observed	Mr(expt)	Mr(calc)	ppm	M	Score	Expect	Rank	U	1	2	Peptide
278		586.3677	585.3604	585.3598	1.01	0	25	1.6	7Score > 39 indicates identity				K.QLVAR.A
312		305.1848	608.3550	608.3533	2.79	0	16	0.2	1Score > 31 indicates identity Score > 21 indicates homology				K.YVSLK.D
658		790.3958	789.3885	789.3868	2.13	0	50	0.01	1Score > 43 indicates identity	U			K.DSNVLDK.V
659		395.7019	789.3892	789.3868	3.05	0	28	1.6	2Score > 43 indicates identity	U			K.DSNVLDK.V
1075	2	481.2794	960.5442	960.5393	5.16	0	65	0.00014	1Score > 39 indicates identity	U			K.VGLFGGAGVGK.T
1076		961.5524	960.5451	960.5393	6.07	0	69	5.8e-005	1Score > 39 indicates identity	U			K.VGLFGGAGVGK.T
1079		962.5441	961.5368	961.5345	2.40	0	46	0.011	2Score > 39 indicates identity	U			R.GVQYVLQR.Y
1081	1	481.7763	961.5380	961.5345	3.67	0	34	0.08	1Score > 39 indicates identity Score > 35 indicates homology	U			R.GVQYVLQR.Y
1361		553.7922	1105.5698	1105.5624	6.77	1	12	1.7	5Score > 42 indicates identity Score > 26 indicates homology	U			K.TVNMMELIR.N
					D:\Xcalibur\Data\Jennifer\PRT1270 Rita DDA\PRT1270_T-BRSC_1_20250714114344.raw Score > 39 indicates identity
1401		1121.6271	1120.6198	1120.6128	6.25	0	109	5.8e-009	1Score > 39 indicates identity	U			K.DTIAGFSGILK.G
					6.26	0	35	0.14	2				QNITFSLGIK + Deamidated (NQ)
					6.26	0	29	0.49	3				QNITFSLGIK + Deamidated (NQ)
					6.26	1	26	0.95	4				DVDKLQYLK
					3.27	1	25	1.2	5				LSMQKSGLLK + Deamidated (NQ); Oxidation (M)
					3.25	0	25	1.4	6				QISTTSMLLK
					19.9	0	22	2.6	7				TTVVGNTSTLK + Deamidated (NQ)
					6.26	1	22	2.8	8				VTQKQFQLK + 2 Deamidated (NQ)
					6.26	1	21	3	9				LTNEFVASLK
					-13.8	0	19	4.8	10				GRPHSVDLLK
1403	1	561.3215	1120.6284	1120.6128	13.9	0	30	0.31	1Score > 38 indicates identity Score > 37 indicates homology	U			K.DTIAGFSGILK.G
1432	1	567.3181	1132.6216	1132.6162	4.83	1	63	9.6e-005	1Score > 39 indicates identity Score > 35 indicates homology	U			R.VALTGLTMAEK.F
1603	2	602.8379	1203.6612	1203.6499	9.40	0	40	0.0059	1Score > 39 indicates identity Score > 30 indicates homology	U			R.DVVPSVYNALK.V
1713		421.8969	1262.6689	1262.6653	2.85	1	46	0.00089	1Score > 41 indicates identity Score > 28 indicates homology	U			R.TIAMGTTDGLKR.G
1786		650.8594	1299.7042	1299.7187	-11.1	1	11	52	9Score > 40 indicates identity				E.VIGAVVDVEFPR.D
2077		484.2708	1449.7906	1449.7827	5.41	1	61	2.1e-005	1Score > 38 indicates identity Score > 27 indicates homology	U			R.YTLAGTEVSALLGR.M
2079	2	725.9044	1449.7942	1449.7827	7.94	1	98	5.5e-009	1Score > 38 indicates identity Score > 28 indicates homology	U			R.YTLAGTEVSALLGR.M
2391		533.3019	1596.8839	1596.8723	7.24	0	86	7.8e-007	1Score > 37 indicates identity	U			R.GLDVVDTGAAISVPVGK.A
2392	1	799.4497	1596.8848	1596.8723	7.85	0	102	1.9e-008	1Score > 37 indicates identity	U			R.GLDVVDTGAAISVPVGK.A
2502		823.4151	1644.8156	1644.7930	13.8	0	73	9.1e-006	1Score > 41 indicates identity Score > 35 indicates homology	U			K.VALVYGQMNEPPGNR.L + Deamidated (NQ)
2559	6	834.9926	1667.9706	1667.9610	5.76	1	116	2.3e-010	1Score > 32 indicates identity	U			R.IVQIIGAVIDVEFPR.D
2561	1	556.9987	1667.9743	1667.9610	7.93	1	75	2.8e-006	1Score > 32 indicates identity	U			R.IVQIIGAVIDVEFPR.D
2571		557.3318	1668.9736	1668.9451	17.1	1	76	2.3e-006	1Score > 33 indicates identity	U			R.IVQIIGAVIDVEFPR.D + Deamidated (NQ)
2655	2	571.3292	1710.9658	1710.9556	5.94	1	53	0.00092	1Score > 35 indicates identity	U			K.YVSLKDTIAGFSGILK.G
2941		928.9542	1855.8938	1855.8952	-0.72	1	21	4.4	5Score > 40 indicates identity	U			R.QLDPLIVGQEHYDTAR.R + 2 Deamidated (NQ)
2943		619.6398	1855.8976	1855.8952	1.29	1	2	6.3	8Score > 40 indicates identity Score > 22 indicates homology	U			R.QLDPLIVGQEHYDTAR.R + 2 Deamidated (NQ)
3087		979.5160	1957.0174	1956.9986	9.64	1	82	2.7e-006	1Score > 39 indicates identity	U			R.FLSQPFFVAEVFTGSPGK.Y
3089	2	653.6786	1958.0140	1957.9826	16.0	1	77	3.3e-006	1Score > 39 indicates identity Score > 35 indicates homology	U			R.FLSQPFFVAEVFTGSPGK.Y + Deamidated (NQ)
3090	1	980.0152	1958.0158	1957.9826	17.0	1	82	2.9e-006	1Score > 39 indicates identity	U			R.FLSQPFFVAEVFTGSPGK.Y + Deamidated (NQ)
3132		995.5179	1989.0212	1989.0055	7.93	0	131	7e-012	1Score > 39 indicates identity Score > 32 indicates homology	U			R.DIASLGIYPAVDPLDSTSR.Q
3857	2	813.0813	2436.2221	2436.1921	12.3	1	71	6.5e-007	1Score > 38 indicates identity Score > 22 indicates homology	U			R.GIHQPAPSFADQAGGNDLLETGIK.V + Deamidated (NQ)
4710		961.9933	3843.9441	3843.9055	10.0	1	26	0.0047	1Score > 33 indicates identity Score > 15 indicates homology	U			K.EGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSR.D + Deamidated (NQ)

42 subsets and intersections (601 subset proteins in total)

2

	Accession	Score	Description
1	EFTU2_PSEPK	1599	Elongation factor Tu-B OS=Pseudomonas putida (strain KT2440) GN=tufB PE=3 SV=1
5	EFTU_MYCS5	42	Elongation factor Tu OS=Mycoplasma synoviae (strain 53) GN=tuf PE=3 SV=1
3	EFTU_CARRP	146	Elongation factor Tu OS=Carsonella ruddii (strain PV) GN=tuf PE=3 SV=1
4	EFTU_ANATD	54	Elongation factor Tu OS=Anaerocellum thermophilum (strain DSM 6725 / Z-1320) GN=tuf PE=3 SV=1
2	EFTU1_PSEPK	1484	Elongation factor Tu-A OS=Pseudomonas putida (strain KT2440) GN=tufA PE=3 SV=1

3

	Accession	Score	Description
1	ATPA_PSEPK	907	ATP synthase subunit alpha OS=Pseudomonas putida (strain KT2440) GN=atpA PE=3 SV=1
3	ATPA_RICAH	176	ATP synthase subunit alpha OS=Rickettsia akari (strain Hartford) GN=atpA PE=3 SV=1
2	ATPA_VEREI	178	ATP synthase subunit alpha OS=Verminephrobacter eiseniae (strain EF01-2) GN=atpA PE=3 SV=1

4

	Accession	Score	Description
1	PORF_PSESY	690	Outer membrane porin F OS=Pseudomonas syringae pv. syringae GN=oprF PE=3 SV=1
2	PORF_PSEAE	143	Outer membrane porin F OS=Pseudomonas aeruginosa GN=oprF PE=1 SV=1

5

	Accession	Score	Description
1	RPOB_PSEPG	513	DNA-directed RNA polymerase subunit beta OS=Pseudomonas putida (strain GB-1) GN=rpoB PE=3 SV=1
5	FTSZ_PSEPK	129	Cell division protein ftsZ OS=Pseudomonas putida (strain KT2440) GN=ftsZ PE=3 SV=3
2	RPOC_PSEP1	418	DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpoC PE=3 SV=1
3	RPOC_PSEU5	335	DNA-directed RNA polymerase subunit beta' OS=Pseudomonas stutzeri (strain A1501) GN=rpoC PE=3 SV=1
6	RPOC_BIFLD	91	DNA-directed RNA polymerase subunit beta' OS=Bifidobacterium longum (strain DJO10A) GN=rpoC PE=3 SV=1
4	RPOC_SYNAS	202	DNA-directed RNA polymerase subunit beta' OS=Syntrophus aciditrophicus (strain SB) GN=rpoC PE=3 SV=1

6

		Accession	Score	Description
	1	RS5_PSEE4	428	30S ribosomal protein S5 OS=Pseudomonas entomophila (strain L48) GN=rpsE PE=3 SV=1

7

		Accession	Score	Description
	1	RL3_PSEP1	378	50S ribosomal protein L3 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplC PE=3 SV=1

8

		Accession	Score	Description
	1	ARPC_PSEPU	369	Antibiotic efflux pump outer membrane protein arpC OS=Pseudomonas putida GN=arpC PE=2 SV=1

9

		Accession	Score	Description
	1	RL2_PSEP1	329	50S ribosomal protein L2 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplB PE=3 SV=1

10

	Accession	Score	Description
1	DLDH2_PSEPU	325	Dihydrolipoamide dehydrogenase OS=Pseudomonas putida GN=lpdG PE=1 SV=4
2	DLDH_AZOVI	161	Dihydrolipoyl dehydrogenase OS=Azotobacter vinelandii PE=1 SV=1

1 2 3 4 5 6 … 23 Next

Not what you expected? Try the select summary.

MASCOT Search Results

Score distribution

Protein Family Summary

Protein families 1–10 (out of 230)

1

56 peptide matches (32 non-duplicate, 24 duplicate)

D:\Xcalibur\Data\Jennifer\PRT1270 Rita DDA\PRT1270_T-BRSC_1_20250714114344.raw

42 subsets and intersections (601 subset proteins in total)

2

3

4

5

6

7

8

9

10