MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita1 sp
MS data file : PRT1270_T-BRSC_1_20250714114344.mgf
Database : SwissProt 57.15 (515,203 sequences; 181,334,896 residues)
Timestamp : 12 Aug 2025 at 22:50:29 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,938

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 39 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 230)


Page: 1 2 3 4 5 6  23 Next 

-1

Accession Score Description
Family member distances as a dendrogram 1 ATPB_PSEPG 1648 ATP synthase subunit beta OS=Pseudomonas putida (strain GB-1) GN=atpD PE=3 SV=1
2 ATPB_LEGPA 425 ATP synthase subunit beta OS=Legionella pneumophila (strain Paris) GN=atpD PE=3 SV=1
Cut threshold

Score Mass Matches Sequences emPAI
ATPB_PSEPG 1648 49415 52 (43) 18 (15) 1.71
ATP synthase subunit beta OS=Pseudomonas putida (strain GB-1) GN=atpD PE=3 SV=1
2 samesets of ATPB_PSEPG
ATPB_PSEPK 1648 49385 52 (43) 18 (15) 1.71
ATP synthase subunit beta OS=Pseudomonas putida (strain KT2440) GN=atpD PE=3 SV=1
ATPB_PSEP1 1648 49385 52 (43) 18 (15) 1.71
ATP synthase subunit beta OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=atpD PE=3 SV=1
ATPB_LEGPA 425 50052 20 (14) 9 (5) 0.43
ATP synthase subunit beta OS=Legionella pneumophila (strain Paris) GN=atpD PE=3 SV=1
3 samesets of ATPB_LEGPA
ATPB_LEGPC 425 50052 20 (14) 9 (5) 0.43
ATP synthase subunit beta OS=Legionella pneumophila (strain Corby) GN=atpD PE=3 SV=1
ATPB_LEGPH 425 50052 20 (14) 9 (5) 0.43
ATP synthase subunit beta OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=atpD PE=3 SV=1
ATPB_LEGPL 425 50052 20 (14) 9 (5) 0.43
ATP synthase subunit beta OS=Legionella pneumophila (strain Lens) GN=atpD PE=3 SV=1

-56 peptide matches (32 non-duplicate, 24 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U 1 2 Peptide
Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U 1 2 Peptide
278   586.3677 585.3604 585.3598 1.01 0 25 1.6 +7Score > 39 indicates identity X K.QLVAR.A
312   305.1848 608.3550 608.3533 2.79 0 16 0.2 +1Score > 31 indicates identity
Score > 21 indicates homology
X X K.YVSLK.D
658   790.3958 789.3885 789.3868 2.13 0 50 0.01 +1Score > 43 indicates identity U X X K.DSNVLDK.V
659   395.7019 789.3892 789.3868 3.05 0 28 1.6 +2Score > 43 indicates identity U X X K.DSNVLDK.V
1075 +2 481.2794 960.5442 960.5393 5.16 0 65 0.00014 +1Score > 39 indicates identity U X X K.VGLFGGAGVGK.T
1076   961.5524 960.5451 960.5393 6.07 0 69 5.8e-005 +1Score > 39 indicates identity U X X K.VGLFGGAGVGK.T
1079   962.5441 961.5368 961.5345 2.40 0 46 0.011 +2Score > 39 indicates identity U X R.GVQYVLQR.Y
1081 +1 481.7763 961.5380 961.5345 3.67 0 34 0.08 +1Score > 39 indicates identity
Score > 35 indicates homology
U X R.GVQYVLQR.Y
1361   553.7922 1105.5698 1105.5624 6.77 1 12 1.7 +5Score > 42 indicates identity
Score > 26 indicates homology
U X X K.TVNMMELIR.N
1401   1121.6271 1120.6198 1120.6128 6.25 0 109 5.8e-009 +1Score > 39 indicates identity U X K.DTIAGFSGILK.G
1403 +1 561.3215 1120.6284 1120.6128 13.9 0 30 0.31 +1Score > 38 indicates identity
Score > 37 indicates homology
U X K.DTIAGFSGILK.G
1432 +1 567.3181 1132.6216 1132.6162 4.83 1 63 9.6e-005 +1Score > 39 indicates identity
Score > 35 indicates homology
U X X R.VALTGLTMAEK.F
1603 +2 602.8379 1203.6612 1203.6499 9.40 0 40 0.0059 +1Score > 39 indicates identity
Score > 30 indicates homology
U X R.DVVPSVYNALK.V
1713   421.8969 1262.6689 1262.6653 2.85 1 46 0.00089 +1Score > 41 indicates identity
Score > 28 indicates homology
U X R.TIAMGTTDGLKR.G
1786   650.8594 1299.7042 1299.7187 -11.1 1 11 52 +9Score > 40 indicates identity X E.VIGAVVDVEFPR.D
2077   484.2708 1449.7906 1449.7827 5.41 1 61 2.1e-005 +1Score > 38 indicates identity
Score > 27 indicates homology
U X R.YTLAGTEVSALLGR.M
2079 +2 725.9044 1449.7942 1449.7827 7.94 1 98 5.5e-009 +1Score > 38 indicates identity
Score > 28 indicates homology
U X R.YTLAGTEVSALLGR.M
2391   533.3019 1596.8839 1596.8723 7.24 0 86 7.8e-007 +1Score > 37 indicates identity U X R.GLDVVDTGAAISVPVGK.A
2392 +1 799.4497 1596.8848 1596.8723 7.85 0 102 1.9e-008 +1Score > 37 indicates identity U X R.GLDVVDTGAAISVPVGK.A
2502   823.4151 1644.8156 1644.7930 13.8 0 73 9.1e-006 +1Score > 41 indicates identity
Score > 35 indicates homology
U X K.VALVYGQMNEPPGNR.L + Deamidated (NQ)
2559 +6 834.9926 1667.9706 1667.9610 5.76 1 116 2.3e-010 +1Score > 32 indicates identity U X R.IVQIIGAVIDVEFPR.D
2561 +1 556.9987 1667.9743 1667.9610 7.93 1 75 2.8e-006 +1Score > 32 indicates identity U X R.IVQIIGAVIDVEFPR.D
2571   557.3318 1668.9736 1668.9451 17.1 1 76 2.3e-006 +1Score > 33 indicates identity U X R.IVQIIGAVIDVEFPR.D + Deamidated (NQ)
2655 +2 571.3292 1710.9658 1710.9556 5.94 1 53 0.00092 +1Score > 35 indicates identity U X K.YVSLKDTIAGFSGILK.G
2941   928.9542 1855.8938 1855.8952 -0.72 1 21 4.4 +5Score > 40 indicates identity U X R.QLDPLIVGQEHYDTAR.R + 2 Deamidated (NQ)
2943   619.6398 1855.8976 1855.8952 1.29 1 2 6.3 +8Score > 40 indicates identity
Score > 22 indicates homology
U X R.QLDPLIVGQEHYDTAR.R + 2 Deamidated (NQ)
3087   979.5160 1957.0174 1956.9986 9.64 1 82 2.7e-006 +1Score > 39 indicates identity U X X R.FLSQPFFVAEVFTGSPGK.Y
3089 +2 653.6786 1958.0140 1957.9826 16.0 1 77 3.3e-006 +1Score > 39 indicates identity
Score > 35 indicates homology
U X X R.FLSQPFFVAEVFTGSPGK.Y + Deamidated (NQ)
3090 +1 980.0152 1958.0158 1957.9826 17.0 1 82 2.9e-006 +1Score > 39 indicates identity U X X R.FLSQPFFVAEVFTGSPGK.Y + Deamidated (NQ)
3132   995.5179 1989.0212 1989.0055 7.93 0 131 7e-012 +1Score > 39 indicates identity
Score > 32 indicates homology
U X R.DIASLGIYPAVDPLDSTSR.Q
3857 +2 813.0813 2436.2221 2436.1921 12.3 1 71 6.5e-007 +1Score > 38 indicates identity
Score > 22 indicates homology
U X R.GIHQPAPSFADQAGGNDLLETGIK.V + Deamidated (NQ)
4710   961.9933 3843.9441 3843.9055 10.0 1 26 0.0047 +1Score > 33 indicates identity
Score > 15 indicates homology
U X K.EGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSR.D + Deamidated (NQ)

+42 subsets and intersections (601 subset proteins in total)


+2

Accession Score Description
Family member distances as a dendrogram 1 EFTU2_PSEPK 1599 Elongation factor Tu-B OS=Pseudomonas putida (strain KT2440) GN=tufB PE=3 SV=1
5 EFTU_MYCS5 42 Elongation factor Tu OS=Mycoplasma synoviae (strain 53) GN=tuf PE=3 SV=1
3 EFTU_CARRP 146 Elongation factor Tu OS=Carsonella ruddii (strain PV) GN=tuf PE=3 SV=1
4 EFTU_ANATD 54 Elongation factor Tu OS=Anaerocellum thermophilum (strain DSM 6725 / Z-1320) GN=tuf PE=3 SV=1
2 EFTU1_PSEPK 1484 Elongation factor Tu-A OS=Pseudomonas putida (strain KT2440) GN=tufA PE=3 SV=1

+3

Accession Score Description
Family member distances as a dendrogram 1 ATPA_PSEPK 907 ATP synthase subunit alpha OS=Pseudomonas putida (strain KT2440) GN=atpA PE=3 SV=1
3 ATPA_RICAH 176 ATP synthase subunit alpha OS=Rickettsia akari (strain Hartford) GN=atpA PE=3 SV=1
2 ATPA_VEREI 178 ATP synthase subunit alpha OS=Verminephrobacter eiseniae (strain EF01-2) GN=atpA PE=3 SV=1

+4

Accession Score Description
Family member distances as a dendrogram 1 PORF_PSESY 690 Outer membrane porin F OS=Pseudomonas syringae pv. syringae GN=oprF PE=3 SV=1
2 PORF_PSEAE 143 Outer membrane porin F OS=Pseudomonas aeruginosa GN=oprF PE=1 SV=1

+5

Accession Score Description
Family member distances as a dendrogram 1 RPOB_PSEPG 513 DNA-directed RNA polymerase subunit beta OS=Pseudomonas putida (strain GB-1) GN=rpoB PE=3 SV=1
5 FTSZ_PSEPK 129 Cell division protein ftsZ OS=Pseudomonas putida (strain KT2440) GN=ftsZ PE=3 SV=3
2 RPOC_PSEP1 418 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpoC PE=3 SV=1
3 RPOC_PSEU5 335 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas stutzeri (strain A1501) GN=rpoC PE=3 SV=1
6 RPOC_BIFLD 91 DNA-directed RNA polymerase subunit beta' OS=Bifidobacterium longum (strain DJO10A) GN=rpoC PE=3 SV=1
4 RPOC_SYNAS 202 DNA-directed RNA polymerase subunit beta' OS=Syntrophus aciditrophicus (strain SB) GN=rpoC PE=3 SV=1

+6

Accession Score Description
1 RS5_PSEE4 428 30S ribosomal protein S5 OS=Pseudomonas entomophila (strain L48) GN=rpsE PE=3 SV=1

+7

Accession Score Description
1 RL3_PSEP1 378 50S ribosomal protein L3 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplC PE=3 SV=1

+8

Accession Score Description
1 ARPC_PSEPU 369 Antibiotic efflux pump outer membrane protein arpC OS=Pseudomonas putida GN=arpC PE=2 SV=1

+9

Accession Score Description
1 RL2_PSEP1 329 50S ribosomal protein L2 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplB PE=3 SV=1

+10

Accession Score Description
Family member distances as a dendrogram 1 DLDH2_PSEPU 325 Dihydrolipoamide dehydrogenase OS=Pseudomonas putida GN=lpdG PE=1 SV=4
2 DLDH_AZOVI 161 Dihydrolipoyl dehydrogenase OS=Azotobacter vinelandii PE=1 SV=1
Page: 1 2 3 4 5 6  23 Next 

Not what you expected? Try the select summary.