MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita1
MS data file : PRT1270_T-BRSC_1_20250714114344.mgf
Database : P-putida 20180924 (5,556 sequences; 1,892,173 residues)
Timestamp : 12 Aug 2025 at 22:47:09 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,938

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 501–600 (out of 2947)


Page: Previous 1 2 3 4 5 6 7 8 9 10 11  30 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3159 1004.0823 2006.1500 2006.1102 19.9 1 1 0.73 +1Score > 13 indicates identity LVLPGVRFAVDAYVNFAR
1609 607.3030 1212.5914 1212.5921 -0.53 0 1 0.99 +1Score > 21 indicates identity
Score > 14 indicates homology
LGLNLHMDGAR + Deamidated (NQ); Oxidation (M)
1940 692.8197 1383.6248 1383.6050 14.3 1 1 3.2 +1Score > 19 indicates identity DALVMACTLFED
2553 556.6461 1666.9165 1666.9301 -8.15 1 1 2.2 +1Score > 17 indicates identity QQMLAIARALLNGPR + Oxidation (M)
1994 703.8947 1405.7748 1405.7565 13.1 1 1 1.6 +1Score > 16 indicates identity LEPALHASVAAKAE
1594 601.3376 1200.6606 1200.6503 8.64 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
ELTAPFAVPTR
2981 626.0083 1875.0031 1875.0254 -11.9 1 1 2.8 +1Score > 18 indicates identity LNLASAFGWQLKTLGQK + Deamidated (NQ)
2752 880.4494 1758.8842 1758.9013 -9.67 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
QNLAPSQARLPAGIGHE + Deamidated (NQ)
4086 898.4551 2692.3435 2692.3313 4.54 1 1 2.5 +1Score > 18 indicates identity NTQAMADDLFAMIGSGKLAVDIQQR
3036 638.9891 1913.9455 1913.9451 0.18 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
QLCAAGAQVLAVSRHMGK + 2 Deamidated (NQ); Oxidation (M)
993 467.7550 933.4954 933.4920 3.74 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
VLPASEYR
2276 772.4090 1542.8034 1542.8055 -1.35 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
QWGWLSINDIRR
3473 721.7141 2162.1205 2162.1041 7.56 0 1 3.8 +1Score > 19 indicates identity GPNTVSYGANALMAVVNILTR + 2 Deamidated (NQ)
2510 550.9413 1649.8021 1649.7818 12.3 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
INSLGAQTAINSQAMK + 4 Deamidated (NQ)
3428 715.3983 2143.1731 2143.1572 7.41 1 1 1.6 +1Score > 16 indicates identity GLMFVHNTLVGLNLRSSIR + Deamidated (NQ); Oxidation (M)
3269 687.3584 2059.0534 2059.0415 5.79 1 1 0.82 +1Score > 20 indicates identity
Score > 13 indicates homology
LEGVGGLKPGYYYYQPVR + Deamidated (NQ)
1305 538.3165 1074.6184 1074.6219 -3.23 1 1 1.6 +1Score > 16 indicates identity MKALIVAASR + Oxidation (M)
2925 923.4431 1844.8716 1844.8363 19.2 1 1 3.9 +1Score > 19 indicates identity QGDPQHKGPNPCVAPIE + 2 Deamidated (NQ)
2922 922.4886 1842.9626 1842.9734 -5.83 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
LGAMQVQRQADALSALR + Oxidation (M)
2722 870.4727 1738.9308 1738.9287 1.22 1 1 3 +1Score > 18 indicates identity LQRMGLPPLSQGALIE + Deamidated (NQ); Oxidation (M)
3345 703.0196 2106.0370 2106.0381 -0.56 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
LQAQYLANLGFQPTGAQQR + 3 Deamidated (NQ)
1724 635.8314 1269.6482 1269.6564 -6.46 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
AGNIQSVNPAGLK + 2 Deamidated (NQ)
2734 873.0016 1743.9886 1743.9632 14.6 1 1 0.89 +1Score > 13 indicates identity QATAGKILFNGQDIIR
4708 957.9722 3827.8597 3827.7896 18.3 0 1 1.3 +1Score > 15 indicates identity AWDANGQLWFNPFNTDGFLADQILVNWQYKPR + 4 Deamidated (NQ)
1089 323.8388 968.4946 968.4927 1.94 1 1 3.7 +1Score > 19 indicates identity ELGHLSDAK
2386 532.9813 1595.9221 1595.8995 14.2 1 1 1.3 +1Score > 15 indicates identity LAQQNGKVVAALNAAK + Deamidated (NQ)
1975 700.4064 1398.7982 1398.7871 7.98 1 1 2.5 +1Score > 17 indicates identity ILGIGEQTLIWR + Deamidated (NQ)
2280 515.6038 1543.7896 1543.8028 -8.58 0 1 0.98 +1Score > 21 indicates identity
Score > 13 indicates homology
LSPQTIAGACGLSLR + Deamidated (NQ)
2913 920.4438 1838.8730 1838.8720 0.56 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
SDDSFVIMARTDALAVE
3331 525.2556 2096.9933 2096.9650 13.5 1 1 4.1 +1Score > 19 indicates identity RLQFDLGQYAQGQQGQVR + 6 Deamidated (NQ)
3533 1098.5725 2195.1304 2195.1369 -2.92 1 1 4.1 +1Score > 20 indicates identity GRTIGLVPQDPMVSLNPTQR + Deamidated (NQ); Oxidation (M)
4063 892.7770 2675.3092 2675.2941 5.63 1 1 3.8 +1Score > 19 indicates identity YNIIMETALDSPHFADFPPDAALK
661 395.7099 789.4052 789.4055 -0.26 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
AGAMSIPK + Oxidation (M)
2431 538.3185 1611.9337 1611.9057 17.4 1 1 0.86 +1Score > 13 indicates identity GALRQAVTLGLGSDVR
205 474.3055 473.2982 473.2962 4.37 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
AGKAK
213 488.2632 487.2559 487.2642 -17.0 0 1 1 +1Score > 24 indicates identity
Score > 13 indicates homology
AVGLE
4018 874.4342 2620.2808 2620.2414 15.0 0 1 3.6 +1Score > 19 indicates identity MHGLGNDFMVLDLVSQHAHIQPK + 2 Deamidated (NQ); 2 Oxidation (M)
492 356.2360 710.4574 710.4551 3.27 1 1 1.1 +1Score > 14 indicates identity RLPGLR
1813 439.8832 1316.6278 1316.6534 -19.4 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
MQPATTLLVPTE + Deamidated (NQ); Oxidation (M)
1927 687.8742 1373.7338 1373.7225 8.29 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
GVGLMGGIELVADK + Oxidation (M)
2529 551.9561 1652.8465 1652.8747 -17.1 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
HDVARIPLSYAQQR
3974 853.7994 2558.3764 2558.4029 -10.4 1 1 2.1 +1Score > 16 indicates identity AQDPFLVLKGLSNCLLGVTSLALK + 2 Deamidated (NQ)
4083 898.4457 2692.3153 2692.3313 -5.94 1 1 2.8 +1Score > 18 indicates identity NTQAMADDLFAMIGSGKLAVDIQQR
3263 1030.5278 2059.0410 2059.0415 -0.20 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
LEGVGGLKPGYYYYQPVR + Deamidated (NQ)
3267 1030.5325 2059.0504 2059.0415 4.37 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
LEGVGGLKPGYYYYQPVR + Deamidated (NQ)
2365 793.4221 1584.8296 1584.8359 -3.95 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
DNIIVGDTTLTPGLR + Deamidated (NQ)
3641 1134.0726 2266.1306 2266.0900 18.0 0 1 4.1 +1Score > 19 indicates identity QVCAAPQQALGDVQLLDEPGR + 2 Deamidated (NQ)
1423 566.2832 1130.5518 1130.5428 7.98 1 1 0.98 +1Score > 22 indicates identity
Score > 13 indicates homology
DDAARTQAQR
1876 452.2395 1353.6967 1353.6928 2.83 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
EDIAFLAPRPPE
2213 755.3834 1508.7522 1508.7722 -13.2 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
AVSIADLKTDNSFK + Deamidated (NQ)
4255 966.8281 2897.4625 2897.4294 11.4 1 1 3.1 +1Score > 18 indicates identity QVQPTLGLGAPTDQVFLLQESNRPGTE + 3 Deamidated (NQ)
1447 570.2629 1138.5112 1138.5230 -10.3 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
WLPSTCGYR
3642 1134.0730 2266.1314 2266.0900 18.3 0 1 4.1 +1Score > 19 indicates identity QVCAAPQQALGDVQLLDEPGR + 2 Deamidated (NQ)
3264 1030.5303 2059.0460 2059.0415 2.23 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
LEGVGGLKPGYYYYQPVR + Deamidated (NQ)
518 362.2429 722.4712 722.4803 -12.5 1 1 0.87 +1Score > 13 indicates identity KHLVVK
2988 471.7310 1882.8949 1882.9095 -7.74 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MVDNLEPNVGTPSPIQR + Deamidated (NQ); Oxidation (M)
3021 636.3368 1905.9886 1905.9805 4.26 1 1 3.4 +1Score > 18 indicates identity LRDMGIEPFLIASCLR + Oxidation (M)
3856 812.4413 2434.3021 2434.3334 -12.9 0 1 2 +1Score > 16 indicates identity TCALNIALLSVPAFVTVFWALK + Deamidated (NQ)
4415 780.6532 3118.5837 3118.5216 19.9 0 1 2.5 +1Score > 17 indicates identity VLGCPQVGLDDNFFALGGHSLMATQIVSR + Deamidated (NQ); Oxidation (M)
4078 898.4351 2692.2835 2692.3313 -17.7 1 1 3 +1Score > 18 indicates identity NTQAMADDLFAMIGSGKLAVDIQQR
3004 947.4995 1892.9844 1893.0029 -9.77 1 1 3.8 +1Score > 19 indicates identity NTTLARLLYANVITAME
4413 624.1025 3115.4761 3115.4550 6.79 1 1 2.5 +1Score > 17 indicates identity DQIVSFEQLVQQAYFAQVSLSSTGFYR + 5 Deamidated (NQ)
1232 346.8469 1037.5189 1037.5294 -10.2 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
GAAGFAAFAGAK
3640 1134.0710 2266.1274 2266.0900 16.5 0 1 4.1 +1Score > 19 indicates identity QVCAAPQQALGDVQLLDEPGR + 2 Deamidated (NQ)
1017 314.8369 941.4889 941.4753 14.5 1 1 4 +1Score > 19 indicates identity MRYISTR + Oxidation (M)
3211 1017.0008 2031.9870 2031.9829 2.03 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
YYWYQLVGLKVINQDE + 2 Deamidated (NQ)
3374 706.3635 2116.0687 2116.0656 1.43 0 1 0.99 +1Score > 20 indicates identity
Score > 13 indicates homology
LMLQQMIDASQVNVNGVVR + 2 Deamidated (NQ)
3592 746.4069 2236.1989 2236.1699 12.9 0 1 2.3 +1Score > 17 indicates identity TDHALLLVNLGSPASTSVADVR + Deamidated (NQ)
4079 898.4389 2692.2949 2692.3313 -13.5 1 1 3 +1Score > 18 indicates identity NTQAMADDLFAMIGSGKLAVDIQQR
3271 1030.5413 2059.0680 2059.0415 12.9 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
LEGVGGLKPGYYYYQPVR + Deamidated (NQ)
2477 545.6313 1633.8721 1633.9039 -19.5 0 1 3.2 +1Score > 18 indicates identity LLAQNAALPPLQNLR + 3 Deamidated (NQ)
3063 967.5350 1933.0554 1933.0244 16.1 1 1 2.5 +1Score > 17 indicates identity LHTQPMDWLIKGQPIR + Deamidated (NQ)
3319 696.7042 2087.0908 2087.0535 17.9 1 1 3.4 +1Score > 18 indicates identity VGQNAKYDINILANGSPAIE + Deamidated (NQ)
2983 940.4762 1878.9378 1878.9298 4.29 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
AGYDPNAAITLWNKMSK
1330 544.7724 1087.5302 1087.5298 0.41 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
KDPFNPVNR + 2 Deamidated (NQ)
2590 837.4710 1672.9274 1672.9083 11.4 1 0 1.7 +1Score > 15 indicates identity FSLGMVPLSGLQPRR + Oxidation (M)
337 314.1957 626.3768 626.3864 -15.2 0 0 2.5 +1Score > 17 indicates identity VKPQR
2612 423.7294 1690.8885 1690.8566 18.8 1 0 3.3 +1Score > 18 indicates identity SDITEVAQTPLFWGK
3972 852.1064 2553.2974 2553.3295 -12.6 0 0 3.5 +1Score > 18 indicates identity TPPIVQACLQSPAVTALLGVGTGMR + Deamidated (NQ); Oxidation (M)
4082 898.4438 2692.3096 2692.3313 -8.05 1 0 3 +1Score > 18 indicates identity NTQAMADDLFAMIGSGKLAVDIQQR
1893 455.5554 1363.6444 1363.6667 -16.3 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
RQFGGGNGQMIAK + Deamidated (NQ)
4611 1145.5787 3433.7143 3433.7202 -1.74 1 0 2.3 +1Score > 17 indicates identity MLRPPFRVLQMPRPAWSLYAYQLIEPDE + 2 Deamidated (NQ); Oxidation (M)
313 614.3244 613.3171 613.3071 16.3 0 0 2.2 +1Score > 16 indicates identity AGLQPE
3053 963.4724 1924.9302 1924.9564 -13.6 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
QHKPVVMALNTQSSIAAE + 2 Deamidated (NQ)
1335 546.8078 1091.6010 1091.5975 3.28 1 0 3.7 +1Score > 19 indicates identity IQSILAEYR
1984 468.9139 1403.7199 1403.7166 2.35 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
AMLMLQRPSWR + Oxidation (M)
3079 488.7485 1950.9649 1950.9833 -9.44 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
LMHEQQVGSIVVVDPQR + Deamidated (NQ); Oxidation (M)
2385 532.9438 1595.8096 1595.8267 -10.7 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
SQLIDRAVDNLSHK + Deamidated (NQ)
1634 408.2354 1221.6844 1221.6942 -8.03 1 0 2.9 +1Score > 18 indicates identity SRLLHGVANVR + Deamidated (NQ)
2352 527.3021 1578.8845 1578.8590 16.1 1 0 2.1 +1Score > 16 indicates identity QAVARLQGLGGGAPGAR + Deamidated (NQ)
2480 545.9552 1634.8438 1634.8376 3.77 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
QGSGYQTRINQLLR + 2 Deamidated (NQ)
3476 1083.5277 2165.0408 2165.0795 -17.9 1 0 4.5 +1Score > 19 indicates identity AFSQLQAPAQALMVRMVMR + 2 Deamidated (NQ); Oxidation (M)
956 920.4532 919.4459 919.4433 2.87 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
MNIEQLR + Deamidated (NQ); Oxidation (M)
2061 481.2459 1440.7159 1440.7208 -3.45 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
SIAGNIQDIQGAPR + 2 Deamidated (NQ)
2372 529.9625 1586.8657 1586.8450 13.0 1 0 3.5 +1Score > 18 indicates identity QIMRVAGIDADLLR + Deamidated (NQ); Oxidation (M)
4167 930.8062 2789.3968 2789.4494 -18.9 1 0 3.5 +1Score > 18 indicates identity LLPGRHPGMSSTQLQAALTTVGHTTSK + Deamidated (NQ)
4910 1039.3535 6230.0773 6230.0459 5.04 1 0 0.93 +1Score > 13 indicates identity FAVLLDDTSLEDGQGVAQQLLCTLDKPMFVDNQLINVTASVGLACAPLHGVDPASLMK + 3 Deamidated (NQ); 2 Oxidation (M)
359 643.3634 642.3561 642.3449 17.5 0 0 2.5 +1Score > 17 indicates identity SLGNPR
675 400.7000 799.3854 799.3824 3.81 0 0 2.9 +1Score > 17 indicates identity QQPAAQR + 2 Deamidated (NQ)
2173 749.3975 1496.7804 1496.7947 -9.52 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
LRDVIPNTVQDAR + Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 8 9 10 11  30 Next 

Not what you expected? Try the select summary.