MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita1
MS data file : PRT1270_T-BRSC_1_20250714114344.mgf
Database : P-putida 20180924 (5,556 sequences; 1,892,173 residues)
Timestamp : 12 Aug 2025 at 22:47:09 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,938

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 401–500 (out of 2947)

Page: Previous 1 2 3 4 5 6 7 8 9 10 … 30 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2377 531.2792 1590.8158 1590.8287 -8.13 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 QGVLLLNTTMTVER + Deamidated (NQ); Oxidation (M)
2862 904.9625 1807.9104 1807.9064 2.22 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 VQQVEHDISGQAQVLR + 2 Deamidated (NQ)
3511 729.0410 2184.1012 2184.1361 -16.0 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 MALDPLAFVEPLLNRDQAR + Oxidation (M)
426 340.7039 679.3932 679.4017 -12.4 1 3 0.52 +1Score > 13 indicates identity TLRYK
672 399.2309 796.4472 796.4443 3.73 1 3 0.94 +1Score > 15 indicates identity AKAPEPGK
2984 627.3363 1878.9871 1878.9687 9.79 1 3 2.3 +1Score > 19 indicates identity DQAAVLTAIKSPQHASLE + Deamidated (NQ)
3489 724.7304 2171.1694 2171.1368 15.0 1 3 1.5 +1Score > 17 indicates identity SSVGVDAQALIATQAPSMLRR + Deamidated (NQ)
1434 567.3363 1132.6580 1132.6386 17.1 1 3 0.89 +1Score > 15 indicates identity AVTASMLRLR + Oxidation (M)
1530 391.5687 1171.6843 1171.6812 2.61 1 3 1 +1Score > 16 indicates identity GATLEVASILAK
1598 602.7956 1203.5766 1203.5805 -3.20 1 3 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 QVAQLEDMLR + 2 Deamidated (NQ)
3037 638.9900 1913.9482 1913.9451 1.59 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 QLCAAGAQVLAVSRHMGK + 2 Deamidated (NQ); Oxidation (M)
3371 706.3593 2116.0561 2116.0656 -4.52 0 3 0.58 +1Score > 20 indicates identity
Score > 13 indicates homology		 LMLQQMIDASQVNVNGVVR + 2 Deamidated (NQ)
1093 324.8391 971.4955 971.4858 9.91 1 3 0.83 +1Score > 21 indicates identity
Score > 14 indicates homology		 TMHVLRAE + Oxidation (M)
530 365.2110 728.4074 728.4181 -14.6 0 3 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 VDQLVR
4498 1070.8776 3209.6110 3209.6035 2.32 1 3 1.5 +1Score > 17 indicates identity AGAIRDMLQNHLLQLLCLVAMEPPAQFE + 2 Oxidation (M)
1088 322.8513 965.5321 965.5294 2.75 0 3 1.8 +1Score > 18 indicates identity LTHSGNLPK
1977 700.4088 1398.8030 1398.7871 11.4 1 3 1.3 +1Score > 16 indicates identity ILGIGEQTLIWR + Deamidated (NQ)
1874 452.2369 1353.6889 1353.6677 15.6 0 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 QVQGLASFDFSR
3136 664.3510 1990.0312 1990.0119 9.66 1 3 0.68 +1Score > 20 indicates identity
Score > 13 indicates homology		 YTVNAAGDPVATGRLITNR + 2 Deamidated (NQ)
3928 835.0794 2502.2164 2502.2247 -3.32 1 3 2.7 +1Score > 19 indicates identity LEFQQDALVAVCGAQMPALLDGR + Deamidated (NQ)
2424 538.2911 1611.8515 1611.8329 11.6 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 ARLSDDLQNLNPTR
871 884.4401 883.4328 883.4188 15.9 0 3 2 +1Score > 18 indicates identity LYGNFDR
1808 439.2498 1314.7276 1314.7143 10.1 1 3 0.65 +1Score > 21 indicates identity
Score > 13 indicates homology		 LSAANAGLATKVAE
3055 642.9924 1925.9554 1925.9709 -8.07 1 3 0.92 +1Score > 20 indicates identity
Score > 15 indicates homology		 FGVIMLIYLNNAWAER + Deamidated (NQ); Oxidation (M)
3529 731.7330 2192.1772 2192.1636 6.18 1 3 1.5 +1Score > 17 indicates identity HRGHLLGAKPMTYLQLANR + Deamidated (NQ); Oxidation (M)
1313 360.8548 1079.5426 1079.5247 16.6 1 2 0.97 +1Score > 21 indicates identity
Score > 15 indicates homology		 QYALTAEQR + Deamidated (NQ)
2999 946.5106 1891.0066 1890.9761 16.2 0 2 2.3 +1Score > 19 indicates identity ISLALLIHPMGQPTPGTE + Deamidated (NQ); Oxidation (M)
2467 816.4149 1630.8152 1630.8427 -16.8 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 QQHAAPTIVPPSAASR + Deamidated (NQ)
2987 627.6393 1879.8961 1879.9172 -11.3 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 VCMVVSQPGSLFLDGVR + Deamidated (NQ); Oxidation (M)
992 934.4897 933.4824 933.4920 -10.2 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 AQLFQAQK + Deamidated (NQ)
4075 897.4591 2689.3555 2689.3421 4.96 1 2 2.3 +1Score > 19 indicates identity SSLIKTLLGQMPHQGQLTLHWPGE + 3 Deamidated (NQ); Oxidation (M)
3532 1097.5713 2193.1280 2193.1025 11.6 0 2 2.7 +1Score > 19 indicates identity LGADANGQLLAIAHDALGQTSR + 2 Deamidated (NQ)
3270 687.3608 2059.0606 2059.0415 9.28 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 LEGVGGLKPGYYYYQPVR + Deamidated (NQ)
906 449.7603 897.5060 897.5032 3.17 0 2 2.2 +1Score > 18 indicates identity ATQIPNVR
4557 827.9548 3307.7901 3307.8367 -14.1 0 2 0.58 +1Score > 13 indicates identity DAWAVMPSGLVLSVIVTVLAVVAAWTGLSNLR
2371 794.4307 1586.8468 1586.8264 12.9 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 SVKTDLPTQDSAGLR
4173 932.1445 2793.4117 2793.3677 15.7 1 2 1.9 +1Score > 18 indicates identity GQLMQEAVPAGHGAMAAILGLDDAVVVE + 2 Oxidation (M)
1934 690.3362 1378.6578 1378.6365 15.5 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 EGSFNLDQGVGVR + 2 Deamidated (NQ)
2107 735.3703 1468.7260 1468.7422 -11.0 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 QAQFIADAAHELR
2380 531.2817 1590.8233 1590.8287 -3.42 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 QGVLLLNTTMTVER + Deamidated (NQ); Oxidation (M)
3153 668.0248 2001.0526 2001.0279 12.3 1 2 2.7 +1Score > 19 indicates identity GASGQAVQNLNILFGLDER
2296 778.4319 1554.8492 1554.8729 -15.2 0 2 2.6 +1Score > 19 indicates identity ASVVDTQALIAALQR
700 406.7358 811.4570 811.4664 -11.6 1 2 2.2 +1Score > 18 indicates identity RIGVDPR
1779 647.9096 1293.8046 1293.7908 10.7 0 2 0.6 +1Score > 13 indicates identity LGIEPDLLLLAK
859 440.2526 878.4906 878.4861 5.13 0 2 1.5 +1Score > 16 indicates identity SYLIDLR
729 414.2723 826.5300 826.5276 2.96 0 2 2.5 +1Score > 19 indicates identity IAQLILR + Deamidated (NQ)
2660 429.2141 1712.8273 1712.8217 3.28 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 NPQQIVTNGLGVQGQR + 5 Deamidated (NQ)
4507 1075.9286 3224.7640 3224.7560 2.49 0 2 0.67 +1Score > 13 indicates identity VTGPIIATALVLCAVFVPAAFISGLTGQFYK + Deamidated (NQ)
2651 570.6468 1708.9186 1708.9035 8.79 1 2 2.7 +1Score > 19 indicates identity QGIEPWELALQLIAE
3329 525.0068 2095.9981 2095.9918 2.99 0 2 2.6 +1Score > 19 indicates identity MALDGVLDVCLANASFQVR + 2 Deamidated (NQ); Oxidation (M)
2275 772.4072 1542.7998 1542.8076 -5.01 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 SPITIDVAACLVER
2955 622.6379 1864.8919 1864.8902 0.89 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 NVSVTNTVGGVTITSQTGE + 2 Deamidated (NQ)
3939 838.4281 2512.2625 2512.2459 6.60 1 2 3.1 +1Score > 19 indicates identity VNYSRAVPAGVGVGYNLGYAAGSDR
4600 682.1797 3405.8621 3405.8925 -8.91 1 2 0.63 +1Score > 13 indicates identity AWLLFAHQGAEPGHKTLLAALQAEPLLALGLR + Deamidated (NQ)
1732 425.5518 1273.6336 1273.6514 -14.0 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 GETVSLIGANGAGK + Deamidated (NQ)
2895 609.2986 1824.8740 1824.8853 -6.22 1 2 2.8 +1Score > 19 indicates identity HSDDIIADLAQALEASR + Deamidated (NQ)
4616 868.4463 3469.7561 3469.7704 -4.13 0 2 1.3 +1Score > 16 indicates identity SQPWLADHVIYGTVVVPGATYAAMALAAVGTPAR + Deamidated (NQ); Oxidation (M)
2316 782.8911 1563.7676 1563.7464 13.6 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 NVMHAGDDLPQVPR + Oxidation (M)
3281 519.2674 2073.0405 2073.0021 18.5 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 VAARQQAAPMTAATGNNQTR + Deamidated (NQ); Oxidation (M)
1015 314.8367 941.4883 941.4930 -5.03 0 2 2.9 +1Score > 19 indicates identity QSLPNNLR + Deamidated (NQ)
3128 663.3181 1986.9325 1986.9204 6.06 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 TETLNGSFDSTITAGMGLR + Deamidated (NQ); Oxidation (M)
1526 586.3070 1170.5994 1170.5815 15.3 0 2 0.95 +1Score > 21 indicates identity
Score > 14 indicates homology		 NQACLPAQLR + Deamidated (NQ)
1879 452.5628 1354.6666 1354.6728 -4.62 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 GQVNQLNDPQLK + 2 Deamidated (NQ)
3757 585.0390 2336.1269 2336.0923 14.8 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 IVRGATGMMQGAGNPSAAINMVR + 3 Deamidated (NQ); 2 Oxidation (M)
2279 515.2868 1542.8386 1542.8518 -8.59 1 2 2.8 +1Score > 19 indicates identity TAVKAISGWVDLQR
3050 641.9767 1922.9083 1922.8880 10.6 0 2 3.2 +1Score > 19 indicates identity AQSGADPLMWHAHIAMR + 2 Oxidation (M)
2880 908.4610 1814.9074 1814.9084 -0.51 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 QLEAVMQQLGLADQLR + 3 Deamidated (NQ)
3477 722.6876 2165.0410 2165.0488 -3.60 1 2 3.2 +1Score > 19 indicates identity GSIFNQAGQLVASSSQEGLIR + 4 Deamidated (NQ)
2871 453.7323 1810.9001 1810.8961 2.18 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 QLGLIEPHRQANNYR + 3 Deamidated (NQ)
4382 512.4182 3068.4655 3068.4291 11.9 1 2 2 +1Score > 17 indicates identity NLTYFITDGKPTYYQSNESTNPSLWK + 2 Deamidated (NQ)
1321 362.5459 1084.6159 1084.6029 11.9 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 VVELANWVR
3582 1115.5751 2229.1356 2229.0969 17.4 1 2 3.1 +1Score > 19 indicates identity MVANVLMLHGINHNMFGKR + 3 Oxidation (M)
2582 558.2963 1671.8671 1671.8428 14.5 1 2 0.83 +1Score > 20 indicates identity
Score > 14 indicates homology		 TGLPDSTLKDQDQVR
3031 638.6462 1912.9168 1912.8836 17.3 1 2 3.1 +1Score > 19 indicates identity MLDLSHLQGEAQAQQVE + Deamidated (NQ); Oxidation (M)
1637 612.3370 1222.6594 1222.6598 -0.26 1 2 0.98 +1Score > 20 indicates identity
Score > 14 indicates homology		 LVSKFYPQIE
1971 699.8881 1397.7616 1397.7555 4.41 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 GKGPGDVLIFLPGE
4430 1046.5585 3136.6537 3136.6127 13.1 1 2 1.8 +1Score > 17 indicates identity AMNRYGLGLARPKPVNNQALIDAGYLYR + 3 Deamidated (NQ)
2486 410.4500 1637.7709 1637.7897 -11.5 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 GILSGGDDSATQYLNK
3265 687.3563 2059.0471 2059.0415 2.73 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 LEGVGGLKPGYYYYQPVR + Deamidated (NQ)
1636 408.5604 1222.6594 1222.6557 2.98 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 HDLIAGIALATE
3704 577.0277 2304.0817 2304.0943 -5.49 0 2 2.6 +1Score > 18 indicates identity GLLSWLQAQNADVICLQDTR + 4 Deamidated (NQ)
4047 663.3160 2649.2349 2649.2614 -10.0 0 2 1.8 +1Score > 17 indicates identity MATHWLNLLQALCAQPHVCVDR + Deamidated (NQ); Oxidation (M)
2083 485.9560 1454.8462 1454.8457 0.35 0 2 0.78 +1Score > 13 indicates identity LGGDSILSLQIIAR
3026 477.7567 1906.9977 1906.9723 13.3 0 2 2.4 +1Score > 18 indicates identity DAHDLLTLFHAMPAAIR + Oxidation (M)
3086 653.0264 1956.0574 1956.0276 15.2 1 2 1.9 +1Score > 17 indicates identity AQVAVDTAQLNLDRSVVR + 2 Deamidated (NQ)
2702 866.8893 1731.7640 1731.7700 -3.42 0 2 1.9 +1Score > 17 indicates identity SVTDAIYNAGYNSNSR + Deamidated (NQ)
1571 397.5548 1189.6426 1189.6390 3.03 1 2 3.2 +1Score > 19 indicates identity RMWASLAAIR + Oxidation (M)
2870 604.3577 1810.0513 1810.0200 17.3 0 2 0.69 +1Score > 13 indicates identity DSGVALLVSQTAALAGLPK
3401 711.0082 2130.0028 2130.0011 0.77 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 AIDQVRQCLDTIANDPGSR + 2 Deamidated (NQ)
4080 898.4412 2692.3018 2692.3313 -10.9 1 2 2.4 +1Score > 18 indicates identity NTQAMADDLFAMIGSGKLAVDIQQR
1420 565.7614 1129.5082 1129.4887 17.3 0 2 3.1 +1Score > 19 indicates identity DQAVSAGQQPE + Deamidated (NQ)
3754 585.0368 2336.1181 2336.0923 11.1 1 2 3.4 +1Score > 19 indicates identity IVRGATGMMQGAGNPSAAINMVR + 3 Deamidated (NQ); 2 Oxidation (M)
677 400.7180 799.4214 799.4188 3.32 1 2 3.2 +1Score > 19 indicates identity QSPAIRE
3225 680.3354 2037.9844 2037.9942 -4.83 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 QDSDRVVQIIHPQMPFE
3262 687.3538 2059.0396 2059.0415 -0.92 1 1 0.98 +1Score > 20 indicates identity
Score > 14 indicates homology		 LEGVGGLKPGYYYYQPVR + Deamidated (NQ)
3897 826.4366 2476.2880 2476.2598 11.4 0 1 2.7 +1Score > 18 indicates identity LQALYQQLNDDAVAGAFALDLAR + Deamidated (NQ)
1116 491.7415 981.4684 981.4516 17.2 1 1 0.96 +1Score > 20 indicates identity
Score > 14 indicates homology		 TGSFSGAAER
427 341.6985 681.3824 681.3810 2.17 0 1 1.6 +1Score > 16 indicates identity LDGLHK
2760 441.2153 1760.8321 1760.8594 -15.5 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 TWHSFTSRVQGGLQR + 2 Deamidated (NQ)
3530 731.7409 2192.2009 2192.1636 17.0 1 1 1.2 +1Score > 15 indicates identity HRGHLLGAKPMTYLQLANR + Deamidated (NQ); Oxidation (M)
Page: Previous 1 2 3 4 5 6 7 8 9 10 … 30 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/