MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita1
MS data file : PRT1270_T-BRSC_1_20250714114344.mgf
Database : P-putida 20180924 (5,556 sequences; 1,892,173 residues)
Timestamp : 12 Aug 2025 at 22:47:09 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,938

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 301–400 (out of 2947)


Page: Previous 1 2 3 4 5 6 7 8 9  30 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
341 314.6988 627.3830 627.3816 2.27 1 4 0.48 +1Score > 14 indicates identity RISPR
2187 501.9212 1502.7418 1502.7262 10.4 0 4 0.39 +1Score > 21 indicates identity
Score > 13 indicates homology
SVQNMPGMPLWVK + Deamidated (NQ); Oxidation (M)
2389 533.2811 1596.8215 1596.8219 -0.30 1 4 0.53 +1Score > 21 indicates identity
Score > 14 indicates homology
QALDDVQRQRPIR + 3 Deamidated (NQ)
2618 424.2229 1692.8625 1692.8656 -1.82 1 4 0.41 +1Score > 21 indicates identity
Score > 13 indicates homology
TASTPHTTRPEPSRR
3756 585.0383 2336.1241 2336.0923 13.6 1 4 1 +1Score > 20 indicates identity
Score > 17 indicates homology
IVRGATGMMQGAGNPSAAINMVR + 3 Deamidated (NQ); 2 Oxidation (M)
3414 712.7114 2135.1124 2135.0971 7.16 1 4 1.4 +1Score > 18 indicates identity ALNVTGNNIANVATTGFKSSR + Deamidated (NQ)
2209 502.6058 1504.7956 1504.7807 9.91 1 4 0.83 +1Score > 20 indicates identity
Score > 16 indicates homology
ILEMQTSAQLTLR + 2 Deamidated (NQ)
814 429.2234 856.4322 856.4403 -9.36 1 4 1.7 +1Score > 19 indicates identity EAQGLPSR
557 372.1884 742.3622 742.3610 1.73 0 4 1.3 +1Score > 18 indicates identity GEPADVR
2075 723.8687 1445.7228 1445.7402 -12.0 1 4 0.88 +1Score > 21 indicates identity
Score > 16 indicates homology
IVSFNLDKDPVAE
1391 560.8049 1119.5952 1119.6036 -7.49 1 4 0.76 +1Score > 21 indicates identity
Score > 16 indicates homology
LNQGRFSGLK + Deamidated (NQ)
3518 1096.5629 2191.1112 2191.0984 5.88 1 4 1 +1Score > 20 indicates identity
Score > 17 indicates homology
NVVVILMESFAGHFVGALGSE + Oxidation (M)
3215 678.3541 2032.0405 2032.0034 18.2 1 4 1 +1Score > 20 indicates identity
Score > 17 indicates homology
GQITKAVADMALNLLDVDE + Deamidated (NQ); Oxidation (M)
2639 568.6237 1702.8493 1702.8678 -10.9 0 4 0.56 +1Score > 21 indicates identity
Score > 14 indicates homology
LTAWEPQFIAATAQR + Deamidated (NQ)
710 408.7083 815.4020 815.4137 -14.3 0 4 0.85 +1Score > 22 indicates identity
Score > 16 indicates homology
ILQNDGR + Deamidated (NQ)
1297 358.5161 1072.5265 1072.5301 -3.42 0 4 0.4 +1Score > 22 indicates identity
Score > 13 indicates homology
LGAWASPQSR + Deamidated (NQ)
2892 912.9805 1823.9464 1823.9417 2.58 1 4 1.8 +1Score > 19 indicates identity LADEFYVTGAIINAATR
3892 825.0925 2472.2557 2472.3006 -18.2 1 4 1.5 +1Score > 18 indicates identity MDSITQAVLGAALQGTVLGRIQGR + 2 Deamidated (NQ); Oxidation (M)
1653 615.3650 1228.7154 1228.7040 9.28 1 4 0.82 +1Score > 16 indicates identity KVHSHGGLPAVK
795 426.7097 851.4048 851.4025 2.78 1 4 1 +1Score > 20 indicates identity
Score > 17 indicates homology
AADYGVEK
2179 500.5881 1498.7425 1498.7160 17.7 1 4 0.4 +1Score > 20 indicates identity
Score > 13 indicates homology
MLEITTMTSVWR + 2 Oxidation (M)
128 403.2311 402.2238 402.2227 2.86 0 4 1 +1Score > 31 indicates identity
Score > 17 indicates homology
AGAGK
2351 790.4482 1578.8818 1578.8590 14.5 1 4 0.96 +1Score > 17 indicates identity QAVARLQGLGGGAPGAR + Deamidated (NQ)
1339 547.7845 1093.5544 1093.5590 -4.17 0 4 0.5 +1Score > 20 indicates identity
Score > 14 indicates homology
MNIPYSVVR + Oxidation (M)
292 597.3410 596.3337 596.3282 9.26 0 4 0.99 +1Score > 17 indicates identity EPPVR
1466 383.8694 1148.5864 1148.5826 3.31 0 4 1 +1Score > 22 indicates identity
Score > 17 indicates homology
YGAIDLINDR
1976 700.4069 1398.7992 1398.7831 11.6 0 4 1.2 +1Score > 17 indicates identity LLLVNNGLTASQR + Deamidated (NQ)
1413 564.8203 1127.6260 1127.6200 5.39 1 4 0.51 +1Score > 20 indicates identity
Score > 14 indicates homology
IWLGRSPSGR
1846 668.8315 1335.6484 1335.6419 4.90 0 4 1 +1Score > 21 indicates identity
Score > 17 indicates homology
YEPGVSVSGTGQR
1250 351.5180 1051.5322 1051.5338 -1.59 1 4 0.83 +1Score > 21 indicates identity
Score > 16 indicates homology
EFGASGFIPK
555 371.6966 741.3786 741.3882 -12.8 0 4 1.8 +1Score > 19 indicates identity QRPQGR + Deamidated (NQ)
750 418.2263 834.4380 834.4236 17.4 1 4 1 +1Score > 20 indicates identity
Score > 17 indicates homology
VAVDEFR
1349 366.8817 1097.6233 1097.6193 3.64 0 4 1.9 +1Score > 19 indicates identity LNLQAGQINK
4081 898.4437 2692.3093 2692.3313 -8.16 1 4 1.3 +1Score > 18 indicates identity NTQAMADDLFAMIGSGKLAVDIQQR
2207 752.9026 1503.7906 1503.8032 -8.35 1 4 1 +1Score > 21 indicates identity
Score > 17 indicates homology
SDSVSLIDVVTLKE
3108 658.0025 1970.9857 1971.0214 -18.1 1 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
ASVNFASTGYFQVKVTPR
232 518.2979 517.2906 517.2860 8.95 1 4 0.79 +1Score > 24 indicates identity
Score > 15 indicates homology
KQGGK + Deamidated (NQ)
3375 706.3636 2116.0690 2116.0656 1.57 0 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
LMLQQMIDASQVNVNGVVR + 2 Deamidated (NQ)
1739 426.5753 1276.7041 1276.6849 15.0 0 4 1.3 +1Score > 17 indicates identity FLLMQLQDLR + Deamidated (NQ)
2893 608.9906 1823.9500 1823.9417 4.51 1 4 2 +1Score > 19 indicates identity LADEFYVTGAIINAATR
819 429.7629 857.5112 857.5083 3.44 1 4 0.68 +1Score > 20 indicates identity
Score > 15 indicates homology
GKVIGTQR
1905 456.2770 1365.8092 1365.7980 8.20 0 4 0.43 +1Score > 13 indicates identity QASLAPIVDLIAR
177 432.2453 431.2380 431.2380 0.077 0 4 1 +1Score > 22 indicates identity
Score > 16 indicates homology
LTAAG
1924 686.8364 1371.6582 1371.6677 -6.92 0 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
SVGGGDQARPCLR
1992 703.8934 1405.7722 1405.7565 11.2 1 4 1.1 +1Score > 17 indicates identity LEPALHASVAAKAE
722 412.7543 823.4940 823.5028 -10.6 0 4 0.43 +1Score > 13 indicates identity RPSPVLR
1115 982.4742 981.4669 981.4590 8.12 0 4 0.72 +1Score > 20 indicates identity
Score > 15 indicates homology
IAFACGSQK + Deamidated (NQ)
2027 474.9420 1421.8042 1421.7990 3.61 1 4 1 +1Score > 16 indicates identity LDLPAPPSTRSLR
3198 1012.5247 2023.0348 2023.0349 -0.039 1 4 1 +1Score > 20 indicates identity
Score > 16 indicates homology
MIWGRFAAPIIYDADIR + Oxidation (M)
2969 624.6476 1870.9210 1870.8908 16.1 1 4 0.53 +1Score > 20 indicates identity
Score > 13 indicates homology
DAGQTADVGSIVQPNLER + 2 Deamidated (NQ)
1248 349.8416 1046.5030 1046.5066 -3.49 0 4 1 +1Score > 21 indicates identity
Score > 16 indicates homology
MQAQPLSVR + 2 Deamidated (NQ); Oxidation (M)
505 717.3850 716.3777 716.3705 10.1 0 4 1 +1Score > 24 indicates identity
Score > 16 indicates homology
VPTDGTK
3167 670.7043 2009.0911 2009.0728 9.10 0 4 1.1 +1Score > 16 indicates identity VQVNQVPGGMISNLANQLK
3488 724.7262 2171.1568 2171.1368 9.19 1 4 1.5 +1Score > 18 indicates identity SSVGVDAQALIATQAPSMLRR + Deamidated (NQ)
2347 526.3126 1575.9160 1575.8847 19.8 0 4 0.55 +1Score > 13 indicates identity YPLVLVPGMLGFVR + Oxidation (M)
3373 706.3613 2116.0621 2116.0656 -1.69 0 4 0.49 +1Score > 20 indicates identity
Score > 13 indicates homology
LMLQQMIDASQVNVNGVVR + 2 Deamidated (NQ)
4429 1046.5573 3136.6501 3136.6127 11.9 1 4 1.2 +1Score > 17 indicates identity AMNRYGLGLARPKPVNNQALIDAGYLYR + 3 Deamidated (NQ)
1645 410.2277 1227.6613 1227.6533 6.50 1 3 0.48 +1Score > 21 indicates identity
Score > 13 indicates homology
QGLEVMPVLNK + Deamidated (NQ)
1119 328.5351 982.5835 982.5923 -9.02 0 3 0.72 +1Score > 15 indicates identity QAAGLLALAR
3006 947.9982 1893.9818 1893.9982 -8.64 1 3 2 +1Score > 19 indicates identity HSVPTIQEIVNLQMLR + Deamidated (NQ); Oxidation (M)
1619 304.6740 1214.6669 1214.6884 -17.7 1 3 0.83 +1Score > 21 indicates identity
Score > 15 indicates homology
NRAIFLTPAGR
3687 767.0585 2298.1537 2298.1460 3.33 1 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
HIGALAMSEPNAGSDVVSMKLR + Oxidation (M)
3272 515.7759 2059.0745 2059.0442 14.7 1 3 2.3 +1Score > 20 indicates identity AIGILGTGMQAQMQLEQLR + 2 Deamidated (NQ)
3576 1112.0238 2222.0330 2222.0280 2.27 1 3 2.2 +1Score > 19 indicates identity NPYALWEVFNDPQTQVSGR + 2 Deamidated (NQ)
464 348.7063 695.3980 695.3966 2.07 0 3 1 +1Score > 16 indicates identity LDLHAK
486 354.1785 706.3424 706.3432 -1.07 0 3 0.64 +1Score > 20 indicates identity
Score > 14 indicates homology
MIGTNR + Oxidation (M)
2539 829.9375 1657.8604 1657.8828 -13.5 1 3 0.65 +1Score > 21 indicates identity
Score > 14 indicates homology
AIQWLIEQGVPFTR + Deamidated (NQ)
3311 696.0250 2085.0532 2085.0942 -19.7 1 3 0.57 +1Score > 20 indicates identity
Score > 13 indicates homology
MSVIAGVFGALPPHRYSQR
3416 1068.5659 2135.1172 2135.0971 9.45 1 3 1.9 +1Score > 19 indicates identity ALNVTGNNIANVATTGFKSSR + Deamidated (NQ)
1307 539.2655 1076.5164 1076.5358 -18.0 0 3 0.88 +1Score > 21 indicates identity
Score > 15 indicates homology
AQTMMPLIR + Deamidated (NQ); Oxidation (M)
1898 683.8281 1365.6416 1365.6525 -7.92 1 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology
ISGGGDKDSFIDR
2594 839.4216 1676.8286 1676.8555 -16.0 0 3 0.68 +1Score > 21 indicates identity
Score > 14 indicates homology
LSAMLNRPLYDLDR + Deamidated (NQ)
641 392.7331 783.4516 783.4603 -11.0 1 3 1.2 +1Score > 17 indicates identity RLSSPPK
1138 332.8546 995.5420 995.5301 12.0 0 3 1.3 +1Score > 17 indicates identity NWLHSALR
1621 406.2027 1215.5863 1215.5666 16.2 1 3 1 +1Score > 21 indicates identity
Score > 16 indicates homology
CKDNDVNPVR
3555 736.7263 2207.1571 2207.1474 4.39 1 3 1.7 +1Score > 18 indicates identity DLLGTLEVPADAYYGIQTLR
1264 353.8618 1058.5636 1058.5720 -7.94 1 3 1 +1Score > 22 indicates identity
Score > 16 indicates homology
VNRAANATIK + 2 Deamidated (NQ)
2814 596.6614 1786.9624 1786.9690 -3.71 0 3 1.9 +1Score > 19 indicates identity LGVGVHLGQTDGPLTPAR
4665 722.7799 3608.8631 3608.8695 -1.76 1 3 0.74 +1Score > 14 indicates identity MRALLVAGSVLLISACSTLPDPDPNQAWIDLTR + Oxidation (M)
1201 514.2891 1026.5636 1026.5611 2.53 0 3 2.1 +1Score > 19 indicates identity IWAGGPSIAR
1056 478.2596 954.5046 954.5022 2.55 1 3 2.1 +1Score > 19 indicates identity VTESTPPPK
2251 765.3801 1528.7456 1528.7508 -3.35 0 3 0.91 +1Score > 20 indicates identity
Score > 15 indicates homology
NLNDNIIINQLLE + 4 Deamidated (NQ)
2036 712.8615 1423.7084 1423.6957 8.98 0 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
NNVQNVWVHGTR + Deamidated (NQ)
2555 834.4700 1666.9254 1666.8963 17.5 0 3 1.2 +1Score > 16 indicates identity ILNLLNIPQDMLPR + 2 Deamidated (NQ); Oxidation (M)
2813 596.6558 1786.9456 1786.9498 -2.39 1 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
QLALICRDLQLTVNK + 3 Deamidated (NQ)
3639 1133.1184 2264.2222 2264.1947 12.2 1 3 1.2 +1Score > 16 indicates identity MSLALVHSRAQVGVQAPAVSVE + Oxidation (M)
3461 1078.0295 2154.0444 2154.0328 5.42 1 3 1 +1Score > 20 indicates identity
Score > 16 indicates homology
AENAATADVLVVSSAINPANPE + 2 Deamidated (NQ)
3168 670.7072 2009.0998 2009.0728 13.4 0 3 0.97 +1Score > 15 indicates identity VQVNQVPGGMISNLANQLK
2504 412.2274 1644.8805 1644.8947 -8.65 0 3 2.4 +1Score > 19 indicates identity AAAVDHLAPVLNDLAR
1829 441.9152 1322.7238 1322.7306 -5.19 1 3 1.5 +1Score > 17 indicates identity HGVLGLDSQLKR + Deamidated (NQ)
3600 748.4085 2242.2037 2242.1780 11.5 1 3 1.4 +1Score > 17 indicates identity GHLSPLDGLGPEAIGIPQLMAR + Deamidated (NQ)
1599 402.2202 1203.6388 1203.6472 -7.03 1 3 0.94 +1Score > 20 indicates identity
Score > 15 indicates homology
QQAQFASLRR
2613 564.6375 1690.8907 1690.8831 4.46 0 3 1.7 +1Score > 18 indicates identity HGYNPLFLYGGVGLGK
968 463.2259 924.4372 924.4375 -0.26 0 3 0.68 +1Score > 20 indicates identity
Score > 14 indicates homology
NIFMIDR + Deamidated (NQ); Oxidation (M)
3180 671.3525 2011.0357 2011.0520 -8.13 1 3 2.3 +1Score > 19 indicates identity VIAAKMAADLAQVDPANAAR + Oxidation (M)
1471 1151.5632 1150.5559 1150.5771 -18.4 1 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology
GATQVFFPER
3686 1150.0837 2298.1528 2298.1743 -9.35 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
VAGNIGIPGLYVTEDPGAVDAAAK + Deamidated (NQ)
2281 515.9508 1544.8306 1544.8423 -7.61 1 3 1 +1Score > 20 indicates identity
Score > 15 indicates homology
AIVQGLSGFQGVGRR + Deamidated (NQ)
1065 479.2552 956.4958 956.4927 3.30 1 3 0.63 +1Score > 20 indicates identity
Score > 13 indicates homology
TINDPIER
944 915.5262 914.5189 914.5185 0.45 0 3 1 +1Score > 21 indicates identity
Score > 15 indicates homology
LVQLASQR + Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 8 9  30 Next 

Not what you expected? Try the select summary.