MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita1
MS data file : PRT1270_T-BRSC_1_20250714114344.mgf
Database : P-putida 20180924 (5,556 sequences; 1,892,173 residues)
Timestamp : 12 Aug 2025 at 22:47:09 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,938

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 281–290 (out of 313)


Page: Previous 1 24 25 26 27 28 29 30 31 32 Next 

+281

Accession Score Description
1 Q88J94_PSEPK 26 Uncharacterized protein OS=Pseudomonas putida (strain KT2440) GN=PP_2755 PE=4 SV=1

+282

Accession Score Description
1 RL27_PSEPK 26 50S ribosomal protein L27 OS=Pseudomonas putida (strain KT2440) GN=rpmA PE=3 SV=1

+283

Accession Score Description
1 Q88GL0_PSEPK 26 Sensory box protein OS=Pseudomonas putida (strain KT2440) GN=PP_3711 PE=4 SV=1

+284

Accession Score Description
1 RIMP_PSEPK 26 Ribosome maturation factor RimP OS=Pseudomonas putida (strain KT2440) GN=rimP PE=3 SV=2

+285

Accession Score Description
1 NUOG_PSEPK 26 NADH-quinone oxidoreductase subunit G OS=Pseudomonas putida (strain KT2440) GN=nuoG PE=3 SV=1

-286

Accession Score Description
1 Q88E13_PSEPK 26 Protocatechuate 3,4-dioxygenase, alpha subunit OS=Pseudomonas putida (strain KT2440) GN=pcaG PE=4 SV=1
Score Mass Matches Sequences emPAI
286.1 Q88E13_PSEPK 26 22491 3 (2) 3 (2) 0.22
Protocatechuate 3,4-dioxygenase, alpha subunit OS=Pseudomonas putida (strain KT2440) GN=pcaG PE=4 SV=1

-3 peptide matches (3 non-duplicate, 0 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
1269   354.2078 1059.6016 1059.5938 7.38 0 15 0.13 +1Score > 18 indicates identity U R.GINIHLHTR.L
1941   692.8296 1383.6446 1383.6306 10.1 1 22 0.032 +2Score > 20 indicates identity U R.LYFDDEAQANAK.C
4774   1025.0435 4096.1449 4096.0728 17.6 1 20 0.011 +1Score > 13 indicates identity U R.TATTFDAGEWTLQTVKPGVVNNAAGVPMAPHINISLFAR.G + 2 Deamidated (NQ)

+287

Accession Score Description
1 Q88FG7_PSEPK 26 NADH dehydrogenase I, L subunit OS=Pseudomonas putida (strain KT2440) GN=nuoL PE=4 SV=1

+288

Accession Score Description
1 Q88Q73_PSEPK 25 Outer membrane protein assembly factor BamD OS=Pseudomonas putida (strain KT2440) GN=bamD PE=3 SV=1

+289

Accession Score Description
1 Q88H19_PSEPK 24 description

+290

Accession Score Description
1 Q88GQ5_PSEPK 24 GGDEF domain protein OS=Pseudomonas putida (strain KT2440) GN=PP_3663 PE=4 SV=1
Page: Previous 1 24 25 26 27 28 29 30 31 32 Next 

Not what you expected? Try the select summary.