MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita1
MS data file : PRT1270_T-BRSC_1_20250714114344.mgf
Database : P-putida 20180924 (5,556 sequences; 1,892,173 residues)
Timestamp : 12 Aug 2025 at 22:47:09 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,938

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 313)


Page: 1 2 3 4 5 6  32 Next 

+1

Accession Score Description
1 Q88NM2_PSEPK 4307 Outer membrane protein H1 OS=Pseudomonas putida (strain KT2440) GN=oprH PE=4 SV=1

+2

Accession Score Description
Family member distances as a dendrogram 1 EFTU2_PSEPK 2609 Elongation factor Tu-B OS=Pseudomonas putida (strain KT2440) GN=tufB PE=3 SV=1
2 EFTU1_PSEPK 2412 Elongation factor Tu-A OS=Pseudomonas putida (strain KT2440) GN=tufA PE=1 SV=1

+3

Accession Score Description
1 ATPB_PSEPK 2344 ATP synthase subunit beta OS=Pseudomonas putida (strain KT2440) GN=atpD PE=3 SV=1

+4

Accession Score Description
1 Q88ES5_PSEPK 2322 Flagellin OS=Pseudomonas putida (strain KT2440) GN=fliC PE=3 SV=1

-5

Accession Score Description
1 Q88L46_PSEPK 1745 Outer membrane protein OprF OS=Pseudomonas putida (strain KT2440) GN=oprF PE=3 SV=1
Score Mass Matches Sequences emPAI
5.1 Q88L46_PSEPK 1745 37217 49 (42) 13 (12) 2.98
Outer membrane protein OprF OS=Pseudomonas putida (strain KT2440) GN=oprF PE=3 SV=1

-49 peptide matches (27 non-duplicate, 22 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
400 +2 336.1563 670.2980 670.2962 2.68 0 14 0.097 +1Score > 16 indicates identity U K.FDFDK.S
402   671.3054 670.2981 670.2962 2.80 0 27 0.0051 +1Score > 16 indicates identity U K.FDFDK.S
421   338.1859 674.3572 674.3599 -3.90 1 3 5.3 +7Score > 22 indicates identity U E.DGKNIK.G + Deamidated (NQ)
476   702.4055 701.3982 701.3959 3.24 1 46 0.00027 +1Score > 23 indicates identity U R.VELDVK.F
477 +1 351.7064 701.3982 701.3959 3.28 1 34 0.0038 +1Score > 23 indicates identity U R.VELDVK.F
755   838.4151 837.4078 837.4055 2.83 0 46 0.00013 +1Score > 20 indicates identity U K.NLADFMK.Q
757 +2 419.7119 837.4092 837.4055 4.53 0 38 0.0007 +1Score > 20 indicates identity
Score > 19 indicates homology
U K.NLADFMK.Q
976   928.4176 927.4103 927.4086 1.81 1 46 6.4e-005 +1Score > 16 indicates identity U K.EFFDSQR.D
977   464.7126 927.4106 927.4086 2.16 1 30 0.0025 +1Score > 16 indicates identity U K.EFFDSQR.D
1535   587.2876 1172.5606 1172.5574 2.75 1 83 3.7e-008 +1Score > 21 indicates identity U R.LGYDEVHNAR.G
1536 +1 391.8609 1172.5609 1172.5574 2.94 1 51 5.9e-005 +1Score > 21 indicates identity U R.LGYDEVHNAR.G
1729 +1 637.8112 1273.6078 1273.6051 2.14 0 81 4.7e-008 +1Score > 20 indicates identity
Score > 20 indicates homology
U R.DHSTFANVGAGAK.W
1730   425.5435 1273.6087 1273.6051 2.79 0 48 0.0001 +1Score > 21 indicates identity U R.DHSTFANVGAGAK.W
1793 +2 436.2396 1305.6970 1305.6929 3.15 0 53 2.2e-005 +1Score > 19 indicates identity U K.SVVKPNSYGDIK.N
1794 -1 653.8558 1305.6970 1305.6929 3.21 0 66 1.2e-006 +1Score > 19 indicates identity U K.SVVKPNSYGDIK.N
1792   653.8555 1305.6964 1305.6929 2.75 0 (59) 5.8e-006 +1Score > 19 indicates identity U K.SVVKPNSYGDIK.N
1895 +1 683.3215 1364.6284 1364.6223 4.48 0 45 0.00016 +1Score > 20 indicates identity U K.WYITDMFYAR.A
2161   498.9244 1493.7514 1493.7474 2.65 1 45 0.0002 +1Score > 21 indicates identity U K.QVLTQQYGVESSR.V
2163 +2 747.8832 1493.7518 1493.7474 2.96 1 85 2.2e-008 +1Score > 21 indicates identity U K.QVLTQQYGVESSR.V
3694 +6 1152.0616 2302.1086 2302.0754 14.5 1 125 2e-012 +1Score > 20 indicates identity U K.NDGNLFGGSIGYFLTDDVELR.L + Deamidated (NQ)
3698 +2 768.3794 2302.1164 2302.0754 17.8 1 93 3e-009 +1Score > 20 indicates identity U K.NDGNLFGGSIGYFLTDDVELR.L + Deamidated (NQ)
4032   659.8141 2635.2273 2635.2038 8.91 1 34 0.0013 +1Score > 18 indicates identity U K.QYPQTTTVVEGHTDSVGPDAYNQK.L + Deamidated (NQ)
4033 +1 879.4168 2635.2286 2635.2038 9.39 1 93 1.8e-009 +1Score > 18 indicates identity U K.QYPQTTTVVEGHTDSVGPDAYNQK.L + Deamidated (NQ)
4744   1003.7405 4010.9329 4010.8936 9.80 0 30 0.0014 +1Score > 14 indicates identity U K.GSNTALDAVYHFNNPYDAIRPYVSAGFSHQSLGQTGR.G + Deamidated (NQ)
4745   803.3950 4011.9386 4011.8776 15.2 0 5 0.46 +1Score > 14 indicates identity U K.GSNTALDAVYHFNNPYDAIRPYVSAGFSHQSLGQTGR.G + 2 Deamidated (NQ)
4746   1003.9928 4011.9421 4011.8776 16.1 0 36 0.00038 +1Score > 14 indicates identity U K.GSNTALDAVYHFNNPYDAIRPYVSAGFSHQSLGQTGR.G + 2 Deamidated (NQ)
4747   803.3967 4011.9471 4011.8776 17.3 0 4 0.62 +1Score > 14 indicates identity U K.GSNTALDAVYHFNNPYDAIRPYVSAGFSHQSLGQTGR.G + 2 Deamidated (NQ)
4748   803.3969 4011.9481 4011.8776 17.6 0 14 0.06 +1Score > 14 indicates identity U K.GSNTALDAVYHFNNPYDAIRPYVSAGFSHQSLGQTGR.G + 2 Deamidated (NQ)

1 subset or intersection (1 subset protein in total)

Score Mass Subset of
Q8LKJ2_ABIGR 27 0 5.1
description

+6

Accession Score Description
1 ATPA_PSEPK 1711 ATP synthase subunit alpha OS=Pseudomonas putida (strain KT2440) GN=atpA PE=3 SV=1

+7

Accession Score Description
1 Q88FB0_PSEPK 1295 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Pseudomonas putida (strain KT2440) GN=kgdB PE=3 SV=1

+8

Accession Score Description
1 Q88FA7_PSEPK 1233 Succinate dehydrogenase flavoprotein subunit OS=Pseudomonas putida (strain KT2440) GN=sdhA PE=3 SV=1

+9

Accession Score Description
1 RPOB_PSEPK 843 DNA-directed RNA polymerase subunit beta OS=Pseudomonas putida (strain KT2440) GN=rpoB PE=3 SV=1

+10

Accession Score Description
1 Q88FA8_PSEPK 775 Succinate dehydrogenase, iron-sulfur protein OS=Pseudomonas putida (strain KT2440) GN=sdhB PE=4 SV=1
Page: 1 2 3 4 5 6  32 Next 

Not what you expected? Try the select summary.