MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : Rita1
MS data file : PRT1270_T-BRSC_1_20250714114344.mgf
Database : P-putida 20180924 (5,556 sequences; 1,892,173 residues)
Timestamp : 12 Aug 2025 at 22:47:09 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : GluC_Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,938

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 19 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Protein families 1–10 (out of 313)


Page: 1 2 3 4 5 6  32 Next 

+1

Accession Score Description
1 Q88NM2_PSEPK 4307 Outer membrane protein H1 OS=Pseudomonas putida (strain KT2440) GN=oprH PE=4 SV=1

+2

Accession Score Description
Family member distances as a dendrogram 1 EFTU2_PSEPK 2609 Elongation factor Tu-B OS=Pseudomonas putida (strain KT2440) GN=tufB PE=3 SV=1
2 EFTU1_PSEPK 2412 Elongation factor Tu-A OS=Pseudomonas putida (strain KT2440) GN=tufA PE=1 SV=1

-3

Accession Score Description
1 ATPB_PSEPK 2344 ATP synthase subunit beta OS=Pseudomonas putida (strain KT2440) GN=atpD PE=3 SV=1
Score Mass Matches Sequences emPAI
3.1 ATPB_PSEPK 2344 49385 58 (49) 20 (17) 2.40
ATP synthase subunit beta OS=Pseudomonas putida (strain KT2440) GN=atpD PE=3 SV=1

-58 peptide matches (33 non-duplicate, 25 duplicate)

Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
Query Dupes Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank U Peptide
278 +1 586.3677 585.3604 585.3598 1.01 0 25 0.027 +2Score > 22 indicates identity U K.QLVAR.A
286   587.3518 586.3445 586.3438 1.16 0 7 1.1 +10Score > 25 indicates identity
Score > 20 indicates homology
U K.QLVAR.A + Deamidated (NQ)
312   305.1848 608.3550 608.3533 2.79 0 16 0.028 +1Score > 13 indicates identity U K.YVSLK.D
501   715.4481 714.4408 714.4388 2.82 0 15 0.27 +4Score > 22 indicates identity U E.VSALLGR.M
502   358.2283 714.4420 714.4388 4.53 0 9 0.74 +7Score > 20 indicates identity U E.VSALLGR.M
658   790.3958 789.3885 789.3868 2.13 0 50 9.6e-005 +1Score > 22 indicates identity U K.DSNVLDK.V
659   395.7019 789.3892 789.3868 3.05 0 28 0.015 +1Score > 22 indicates identity U K.DSNVLDK.V
1075 +2 481.2794 960.5442 960.5393 5.16 0 65 8.9e-007 +1Score > 17 indicates identity U K.VGLFGGAGVGK.T
1076   961.5524 960.5451 960.5393 6.07 0 69 3.7e-007 +1Score > 17 indicates identity U K.VGLFGGAGVGK.T
1079   962.5441 961.5368 961.5345 2.40 0 47 8e-005 +2Score > 18 indicates identity U R.GVQYVLQR.Y
1081 +1 481.7763 961.5380 961.5345 3.67 0 34 0.0016 +1Score > 18 indicates identity U R.GVQYVLQR.Y
1082   482.2677 962.5208 962.5185 2.41 0 7 1.1 +3Score > 20 indicates identity U R.GVQYVLQR.Y + Deamidated (NQ)
1361   553.7922 1105.5698 1105.5624 6.77 1 12 0.083 +1Score > 21 indicates identity
Score > 13 indicates homology
U K.TVNMMELIR.N
1368   554.2952 1106.5758 1106.5641 10.6 1 9 0.83 +2Score > 21 indicates identity U R.TIAMGSTEGLK.R
1401   1121.6271 1120.6198 1120.6128 6.25 0 109 5.1e-011 +1Score > 18 indicates identity U K.DTIAGFSGILK.G
1403 +1 561.3215 1120.6284 1120.6128 13.9 0 30 0.0034 +1Score > 17 indicates identity U K.DTIAGFSGILK.G
1432 +1 567.3181 1132.6216 1132.6162 4.83 1 63 1.8e-006 +1Score > 20 indicates identity
Score > 18 indicates homology
U R.VALTGLTMAEK.F
1603 +2 602.8379 1203.6612 1203.6499 9.40 0 40 0.00041 +1Score > 19 indicates identity U R.DVVPSVYNALK.V
2077   484.2708 1449.7906 1449.7827 5.41 1 61 2.4e-006 +1Score > 17 indicates identity U R.YTLAGTEVSALLGR.M
2079 +2 725.9044 1449.7942 1449.7827 7.94 1 98 3.8e-010 +1Score > 17 indicates identity U R.YTLAGTEVSALLGR.M
2391   533.3019 1596.8839 1596.8723 7.24 0 86 9.2e-009 +1Score > 18 indicates identity U R.GLDVVDTGAAISVPVGK.A
2392 +1 799.4497 1596.8848 1596.8723 7.85 0 102 2.2e-010 +1Score > 18 indicates identity U R.GLDVVDTGAAISVPVGK.A
2502   823.4151 1644.8156 1644.7930 13.8 0 73 3.4e-007 +1Score > 21 indicates identity U K.VALVYGQMNEPPGNR.L + Deamidated (NQ)
2559 +6 834.9926 1667.9706 1667.9610 5.76 1 116 2.8e-012 +1Score > 13 indicates identity U R.IVQIIGAVIDVEFPR.D
2561 +1 556.9987 1667.9743 1667.9610 7.93 1 75 3.5e-008 +1Score > 13 indicates identity U R.IVQIIGAVIDVEFPR.D
2571   557.3318 1668.9736 1668.9451 17.1 1 76 2.3e-008 +1Score > 13 indicates identity U R.IVQIIGAVIDVEFPR.D + Deamidated (NQ)
2655 -2 571.3292 1710.9658 1710.9556 5.94 1 53 1.1e-005 +1Score > 16 indicates identity U K.YVSLKDTIAGFSGILK.G
2656   571.3301 1710.9685 1710.9556 7.52 1 (39) 0.00025 +1Score > 16 indicates identity U K.YVSLKDTIAGFSGILK.G
2657   571.3311 1710.9715 1710.9556 9.27 1 (38) 0.00037 +1Score > 16 indicates identity U K.YVSLKDTIAGFSGILK.G
3087   979.5160 1957.0174 1956.9986 9.64 1 82 3.1e-008 +1Score > 19 indicates identity U R.FLSQPFFVAEVFTGSPGK.Y
3089 +2 653.6786 1958.0140 1957.9826 16.0 1 77 8.3e-008 +1Score > 19 indicates identity U R.FLSQPFFVAEVFTGSPGK.Y + Deamidated (NQ)
3090 +1 980.0152 1958.0158 1957.9826 17.0 1 82 2.9e-008 +1Score > 19 indicates identity U R.FLSQPFFVAEVFTGSPGK.Y + Deamidated (NQ)
3132   995.5179 1989.0212 1989.0055 7.93 0 131 4.6e-013 +1Score > 20 indicates identity U R.DIASLGIYPAVDPLDSTSR.Q
3857 +2 813.0813 2436.2221 2436.1921 12.3 1 71 3.3e-007 +1Score > 19 indicates identity U R.GIHQPAPSFADQAGGNDLLETGIK.V + Deamidated (NQ)
4710   961.9933 3843.9441 3843.9055 10.0 1 26 0.0053 +1Score > 15 indicates identity U K.EGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSR.D + Deamidated (NQ)

1 subset or intersection (2 subset proteins in total)

Score Mass Subset of
Q88EE9_PSEPK 25 0 3.1
description
1 sameset of Q88EE9_PSEPK
Q88KZ9_PSEPK 25 98034
DNA topoisomerase 1 OS=Pseudomonas putida (strain KT2440) GN=topA PE=3 SV=1

+4

Accession Score Description
1 Q88ES5_PSEPK 2322 Flagellin OS=Pseudomonas putida (strain KT2440) GN=fliC PE=3 SV=1

+5

Accession Score Description
1 Q88L46_PSEPK 1745 Outer membrane protein OprF OS=Pseudomonas putida (strain KT2440) GN=oprF PE=3 SV=1

+6

Accession Score Description
1 ATPA_PSEPK 1711 ATP synthase subunit alpha OS=Pseudomonas putida (strain KT2440) GN=atpA PE=3 SV=1

+7

Accession Score Description
1 Q88FB0_PSEPK 1295 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Pseudomonas putida (strain KT2440) GN=kgdB PE=3 SV=1

+8

Accession Score Description
1 Q88FA7_PSEPK 1233 Succinate dehydrogenase flavoprotein subunit OS=Pseudomonas putida (strain KT2440) GN=sdhA PE=3 SV=1

+9

Accession Score Description
1 RPOB_PSEPK 843 DNA-directed RNA polymerase subunit beta OS=Pseudomonas putida (strain KT2440) GN=rpoB PE=3 SV=1

+10

Accession Score Description
1 Q88FA8_PSEPK 775 Succinate dehydrogenase, iron-sulfur protein OS=Pseudomonas putida (strain KT2440) GN=sdhB PE=4 SV=1
Page: 1 2 3 4 5 6  32 Next 

Not what you expected? Try the select summary.