MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 2 |
| MS data file | : | PRT1245_Other_P1_B10.mgf |
| Database | : | K-marxianus 20241107 (5,052 sequences; 2,515,027 residues) |
| Timestamp | : | 24 Jun 2025 at 21:29:11 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,780 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 1070 |
372.6872 | 743.3598 | 743.3490 | 14.6 | 0 | 1 | 1.9 | 1Score > 16 indicates identity |
EGTYFK |
| 1892 |
511.2722 | 1020.5298 | 1020.5240 | 5.73 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
ETALDFIGR |
| 2751 |
633.8244 | 1265.6342 | 1265.6438 | -7.55 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
DIFSMILQQR + Oxidation (M) |
| 2867 |
693.3414 | 1384.6682 | 1384.6946 | -19.0 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
NANILRQDTPNK + 2 Deamidated (NQ) |
| 4730 |
1100.7581 | 4399.0033 | 4399.0511 | -10.9 | 1 | 1 | 2.6 | 1Score > 17 indicates identity |
WMAIAKASIDDGTMVSGDLDLGYEGILGIWNGLEGLSNQNR + 4 Deamidated (NQ); Oxidation (M) |
| 2698 |
611.8311 | 1221.6476 | 1221.6353 | 10.1 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
EPGNGHLEKIK + Deamidated (NQ) |
| 2738 |
629.8005 | 1257.5864 | 1257.5990 | -9.94 | 0 | 1 | 3.2 | 1Score > 18 indicates identity |
YSSTFLSSNPR |
| 4673 |
1163.5531 | 3487.6375 | 3487.5765 | 17.5 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
RFQQDDAHIFCTQDQIEQEIANIFEFLK + 5 Deamidated (NQ) |
| 1293 |
860.4160 | 859.4087 | 859.3977 | 12.9 | 0 | 1 | 3.4 | 1Score > 18 indicates identity |
WWSQPR + Deamidated (NQ) |
| 2859 |
688.8450 | 1375.6754 | 1375.6765 | -0.76 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
VAANMNRNINIK + 3 Deamidated (NQ); Oxidation (M) |
| 3742 |
1021.9371 | 2041.8596 | 2041.8204 | 19.2 | 0 | 1 | 1.9 | 1Score > 16 indicates identity |
SNGSSMASPNAELQQDDMK + Deamidated (NQ); 2 Oxidation (M) |
| 3244 |
817.9081 | 1633.8016 | 1633.7907 | 6.69 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
RSSNVTNSNTIVSPR + 3 Deamidated (NQ) |
| 3493 |
920.4440 | 1838.8734 | 1838.8898 | -8.88 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
NNSDYDQVNLLTTTIK + Deamidated (NQ) |
| 3339 |
855.3578 | 1708.7010 | 1708.7289 | -16.3 | 1 | 1 | 1.4 | 1Score > 15 indicates identity |
GGNSNNGSSSTGKHFQK + 3 Deamidated (NQ) |
| 3240 |
544.9421 | 1631.8045 | 1631.8042 | 0.16 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
KNAENPDLFLDINK + 2 Deamidated (NQ) |
| 3645 |
987.0695 | 1972.1244 | 1972.1027 | 11.0 | 1 | 1 | 1 | 1Score > 13 indicates identity |
VQLLNIVRNIATMTAGLK + 2 Deamidated (NQ); Oxidation (M) |
| 3907 |
1061.4888 | 2120.9630 | 2120.9507 | 5.83 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
EEDQGFPVLMGGPLSNGMAR + Deamidated (NQ); Oxidation (M) |
| 4088 |
1131.5520 | 2261.0894 | 2261.0782 | 4.99 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
LLFMALNDEVFAIQMEAMK + 3 Oxidation (M) |
| 931 |
333.2029 | 664.3912 | 664.3908 | 0.71 | 1 | 0 | 2.7 | 1Score > 17 indicates identity |
KNIYK |
| 2801 |
659.3288 | 1316.6430 | 1316.6394 | 2.73 | 0 | 0 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
SMPAQGVDDLIR + Oxidation (M) |
| 866 |
624.3364 | 623.3291 | 623.3391 | -16.0 | 0 | 0 | 3.4 | 1Score > 18 indicates identity |
ATAPHK |
| 4202 |
789.7214 | 2366.1424 | 2366.0995 | 18.1 | 0 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
SMLLSGTDNHLAGLGQMAEYAR + 2 Oxidation (M) |
| 3061 |
760.3810 | 1518.7474 | 1518.7613 | -9.12 | 1 | 0 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
MSQKVGHTGLAFAR + Deamidated (NQ); Oxidation (M) |
| 1395 |
898.3911 | 897.3838 | 897.4014 | -19.6 | 0 | 0 | 1.7 | 1Score > 15 indicates identity |
GNASFVMR + Deamidated (NQ); Oxidation (M) |
| 3724 |
1014.0004 | 2025.9862 | 2025.9643 | 10.8 | 1 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
DISINSWDLVNESYSKR + Deamidated (NQ) |
| 3205 |
805.8698 | 1609.7250 | 1609.7233 | 1.08 | 1 | 0 | 4.5 | 1Score > 19 indicates identity |
FSNSFTTQNNHRR + 2 Deamidated (NQ) |
| 1054 |
371.1802 | 740.3458 | 740.3453 | 0.73 | 0 | 0 | 1.9 | 1Score > 16 indicates identity |
GIDHNGK + Deamidated (NQ) |
| 1122 |
391.1906 | 780.3666 | 780.3766 | -12.8 | 0 | 0 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
YGSDALR |
| 1261 |
425.1967 | 848.3788 | 848.3875 | -10.2 | 0 | 0 | 3.7 | 1Score > 19 indicates identity |
STNQQLR + 3 Deamidated (NQ) |
| 2412 |
571.7616 | 1141.5086 | 1141.5186 | -8.72 | 0 | 0 | 3 | 1Score > 18 indicates identity |
HNVDNAMTPK + Oxidation (M) |
| 1198 |
818.4114 | 817.4041 | 817.3930 | 13.6 | 0 | 0 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
LSNDVNR + Deamidated (NQ) |
| 3562 |
952.9564 | 1903.8982 | 1903.8945 | 1.96 | 1 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
GEEPSADMVERAESLIR + Oxidation (M) |
| 3327 |
568.6175 | 1702.8307 | 1702.8560 | -14.9 | 0 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
NDIQMDLGVVNLSLR + Deamidated (NQ); Oxidation (M) |
| 2001 |
1044.5116 | 1043.5043 | 1043.5247 | -19.5 | 0 | 0 | 4.3 | 1Score > 19 indicates identity |
LQQEQLQR + 2 Deamidated (NQ) |
| 2666 |
601.2970 | 1200.5794 | 1200.6026 | -19.3 | 0 | 0 | 4.2 | 1Score > 19 indicates identity |
WLLDNSPEVK + Deamidated (NQ) |
| 3057 |
759.8602 | 1517.7058 | 1517.7362 | -20.0 | 0 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
FNAVLENTPSSDPK |
| 4116 |
1147.5597 | 2293.1048 | 2293.0631 | 18.2 | 0 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
DMLQSASGNISVNDDIDEILK + Deamidated (NQ); Oxidation (M) |
| 4163 |
775.3820 | 2323.1242 | 2323.1583 | -14.7 | 1 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
KFVEEENAATLQLGEEFQLK + Deamidated (NQ) |
| 1662 |
968.4698 | 967.4625 | 967.4467 | 16.4 | 0 | 0 | 4.6 | 1Score > 19 indicates identity |
GGATMMLGSK + Oxidation (M) |
| 853 |
615.3472 | 614.3399 | 614.3387 | 1.92 | 0 | 0 | 2.5 | 1Score > 17 indicates identity |
AKPNGK + Deamidated (NQ) |
| 2858 |
688.8447 | 1375.6748 | 1375.6765 | -1.20 | 1 | 0 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
VAANMNRNINIK + 3 Deamidated (NQ); Oxidation (M) |
| 4004 |
1091.9956 | 2181.9766 | 2181.9370 | 18.2 | 0 | 0 | 4.5 | 1Score > 19 indicates identity |
QTSSSSPATTGVGGSNGNSNSAGR + 2 Deamidated (NQ) |
| 4660 |
863.4641 | 3449.8273 | 3449.8268 | 0.14 | 1 | 0 | 2.2 | 1Score > 16 indicates identity |
LADMPSNEIATIFHANVLSTIKLIQAFHPLK + 2 Deamidated (NQ); Oxidation (M) |
| 2722 |
623.3361 | 1244.6576 | 1244.6360 | 17.4 | 1 | 0 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
ERIATQDGNLK + Deamidated (NQ) |
| 1753 |
991.4918 | 990.4845 | 990.4771 | 7.53 | 1 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
ATRVFPGDE |
| 1791 |
500.2411 | 998.4676 | 998.4531 | 14.5 | 0 | 0 | 3.6 | 1Score > 18 indicates identity |
WGQIGYMK + Deamidated (NQ); Oxidation (M) |
| 2333 |
560.7728 | 1119.5310 | 1119.5230 | 7.18 | 0 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
SQVLECQQK + Deamidated (NQ) |
| 3882 |
1055.5112 | 2109.0078 | 2109.0201 | -5.79 | 1 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
TQVLKFNEYVHMTNNLR + 3 Deamidated (NQ) |
| 4058 |
746.6814 | 2237.0224 | 2237.0416 | -8.59 | 1 | 0 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
ISDNGGNLSMGQRQLLCLSR + 3 Deamidated (NQ); Oxidation (M) |
| 3869 |
701.9990 | 2102.9752 | 2102.9942 | -9.07 | 1 | 0 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
EKLEDQLQGMPFTAHVSR + 2 Deamidated (NQ); Oxidation (M) |
| 4406 |
698.1235 | 2788.4649 | 2788.4224 | 15.2 | 1 | 0 | 3.4 | 1Score > 18 indicates identity |
NISAHTSEVNFFNIAYLFIKNFAK + Deamidated (NQ) |
| 894 |
641.3375 | 640.3302 | 640.3254 | 7.52 | 0 | 0 | 3.7 | 1Score > 18 indicates identity |
YIAMK + Oxidation (M) |
| 2525 |
582.8090 | 1163.6034 | 1163.6121 | -7.43 | 1 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
AGWRLSSMLK + Oxidation (M) |
| 3317 |
847.3821 | 1692.7496 | 1692.7698 | -11.9 | 0 | 0 | 3.7 | 1Score > 18 indicates identity |
LPIGDSSMEMIEEAR + Oxidation (M) |
| 4026 |
734.7404 | 2201.1994 | 2201.2209 | -9.76 | 1 | 0 | 2.9 | 1Score > 17 indicates identity |
LATVTRVPVNPFDVSAIVFR + Deamidated (NQ) |
| 2843 |
452.2327 | 1353.6763 | 1353.6928 | -12.2 | 1 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
DKFLNIAQDYK |
| 1376 |
891.4309 | 890.4236 | 890.4345 | -12.2 | 0 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
TVNLNSNK + 2 Deamidated (NQ) |
| 2281 |
553.2939 | 1104.5732 | 1104.5710 | 2.06 | 1 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
RQSMVEVTR |
| 2711 |
618.8025 | 1235.5904 | 1235.6146 | -19.5 | 1 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
QNFKVDSEIR + Deamidated (NQ) |
| 1470 |
460.2497 | 918.4848 | 918.4732 | 12.7 | 0 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
ADLMLDIL + Oxidation (M) |
| 4740 |
1010.0935 | 5045.4311 | 5045.3998 | 6.21 | 1 | 0 | 2.8 | 1Score > 17 indicates identity |
VSMANAGPNTNACQFFITTSNEPMPHLDGKHVVFGQVISGLEDLIR + 2 Deamidated (NQ); 2 Oxidation (M) |
| 1769 |
995.4869 | 994.4796 | 994.4971 | -17.6 | 0 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
DSIEFSGLK |
| 2266 |
552.2559 | 1102.4972 | 1102.5077 | -9.47 | 0 | 0 | 3.8 | 1Score > 18 indicates identity |
CNPNTEVLR + Deamidated (NQ) |
| 2464 |
576.7684 | 1151.5222 | 1151.5095 | 11.1 | 0 | 0 | 4.7 | 1Score > 19 indicates identity |
SPSNDNLYDK |
| 3198 |
802.4115 | 1602.8084 | 1602.7790 | 18.4 | 1 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
IALENYWSHRNAK + 2 Deamidated (NQ) |
| 1059 |
742.4113 | 741.4040 | 741.4021 | 2.60 | 0 | 0 | 1.9 | 1Score > 15 indicates identity |
VPSQSPK |
| 1189 |
814.3699 | 813.3626 | 813.3657 | -3.81 | 0 | 0 | 1.7 | 1Score > 15 indicates identity |
TFDQFR + Deamidated (NQ) |
| 1443 |
456.2314 | 910.4482 | 910.4409 | 8.03 | 0 | 0 | 4.2 | 1Score > 19 indicates identity |
WLANHDR |
| 2593 |
589.8148 | 1177.6150 | 1177.5979 | 14.6 | 0 | 0 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
NQIYDTSPLK |
| 3380 |
873.9319 | 1745.8492 | 1745.8294 | 11.4 | 0 | 0 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
WNNQMKPLVQNLNK + 4 Deamidated (NQ); Oxidation (M) |
| 1749 |
991.4674 | 990.4601 | 990.4692 | -9.16 | 0 | 0 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
SLDMGPQVK + Deamidated (NQ); Oxidation (M) |
| 2917 |
718.3453 | 1434.6760 | 1434.6561 | 13.9 | 0 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
QLHTMEQTQYR + Deamidated (NQ) |
| 3096 |
513.5787 | 1537.7143 | 1537.6864 | 18.1 | 0 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
EMEAMRPEGTLSR + 2 Oxidation (M) |
| 3423 |
889.4370 | 1776.8594 | 1776.8570 | 1.36 | 0 | 0 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
ELEDFAFPDPETIVR |
| 859 |
309.6662 | 617.3178 | 617.3173 | 0.90 | 0 | 0 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
IGNWK + Deamidated (NQ) |
| 1569 |
472.7390 | 943.4634 | 943.4610 | 2.56 | 0 | 0 | 3.8 | 1Score > 18 indicates identity |
QSLAPNANK + 2 Deamidated (NQ) |
| 1893 |
1021.5491 | 1020.5418 | 1020.5240 | 17.5 | 0 | 0 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
ETALDFIGR |
| 4446 |
962.7916 | 2885.3530 | 2885.4083 | -19.2 | 0 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
GYPVNQPNEQVGLPSDFAKPQSIIQR + 4 Deamidated (NQ) |
| 2775 |
643.8293 | 1285.6440 | 1285.6375 | 5.13 | 1 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
EVGNVQNNEKR |
| 3137 |
521.9329 | 1562.7769 | 1562.7953 | -11.8 | 0 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
SRPYNYIPSGRPR + Deamidated (NQ) |
| 3454 |
605.2972 | 1812.8698 | 1812.8981 | -15.6 | 0 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
LGPNYLHIPVNCPYR + Deamidated (NQ) |
| 4155 |
1156.0460 | 2310.0774 | 2310.0585 | 8.21 | 1 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
SATRNSSFSISQQGQGQGQGGAR + 2 Deamidated (NQ) |
| 4141 |
768.7222 | 2303.1448 | 2303.1546 | -4.26 | 1 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
VARSLDNAASTWIWTVNELR + 2 Deamidated (NQ) |
| 1549 |
939.4653 | 938.4580 | 938.4644 | -6.76 | 1 | 0 | 4.9 | 1Score > 20 indicates identity |
KVSGNFMR + Deamidated (NQ) |
| 3081 |
767.3748 | 1532.7350 | 1532.7259 | 5.95 | 1 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
ARAWDEFVEANPK + Deamidated (NQ) |
| 3994 |
725.3459 | 2173.0159 | 2172.9845 | 14.4 | 0 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
ENPDVVLVMDGGQGTELENR + 2 Deamidated (NQ) |
| 1891 |
1021.5353 | 1020.5280 | 1020.5240 | 3.94 | 0 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
ETALDFIGR |
| 2761 |
636.3211 | 1270.6276 | 1270.6292 | -1.23 | 0 | 0 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
LLQDEQLPNAK + 3 Deamidated (NQ) |
| 3595 |
968.4989 | 1934.9832 | 1934.9870 | -1.95 | 0 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
IISNMNGSVVDSLELLSK + Deamidated (NQ); Oxidation (M) |
| 1 |
300.2086 | 299.2013 | |||||||
| 2 |
301.1436 | 300.1363 | |||||||
| 3 |
301.1436 | 300.1363 | |||||||
| 4 |
301.1437 | 300.1364 | |||||||
| 5 |
301.1440 | 300.1367 | |||||||
| 6 |
301.1440 | 300.1367 | |||||||
| 7 |
301.1440 | 300.1367 | |||||||
| 8 |
301.1444 | 300.1371 | |||||||
| 9 |
301.2213 | 300.2140 | |||||||
| 10 |
303.8864 | 302.8791 | |||||||
| 11 |
303.8865 | 302.8792 | |||||||
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/