MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 2 |
| MS data file | : | PRT1245_Other_P1_B10.mgf |
| Database | : | K-marxianus 20241107 (5,052 sequences; 2,515,027 residues) |
| Timestamp | : | 24 Jun 2025 at 21:29:11 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,780 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 2012 |
1048.5187 | 1047.5114 | 1047.5025 | 8.50 | 1 | 2 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
FKYANDYK |
| 4130 |
766.6998 | 2297.0776 | 2297.0369 | 17.7 | 0 | 2 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
LSDELEDSVVYSNQNTPMQK + Deamidated (NQ) |
| 1738 |
987.4643 | 986.4570 | 986.4743 | -17.5 | 0 | 2 | 2.6 | 1Score > 18 indicates identity |
NPLPSMSPK + Deamidated (NQ); Oxidation (M) |
| 2847 |
682.3728 | 1362.7310 | 1362.7143 | 12.3 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
STPPSDPAKAAPPK |
| 1540 |
469.7159 | 937.4172 | 937.3997 | 18.7 | 0 | 2 | 2.3 | 1Score > 18 indicates identity |
AMGGTCVNK + Deamidated (NQ) |
| 2074 |
1060.5176 | 1059.5103 | 1059.5057 | 4.36 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
NGSQQQNKR + Deamidated (NQ) |
| 3374 |
871.9055 | 1741.7964 | 1741.8271 | -17.6 | 0 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
NEIGGQNHVSFSVQPK + 2 Deamidated (NQ) |
| 4269 |
827.4291 | 2479.2655 | 2479.2853 | -8.00 | 1 | 2 | 3.5 | 1Score > 20 indicates identity |
RTLASGIGTSGSGLGGIIFNLGMQR + Deamidated (NQ); Oxidation (M) |
| 897 |
321.1849 | 640.3552 | 640.3656 | -16.2 | 0 | 1 | 1.1 | 1Score > 14 indicates identity |
VAAQPR |
| 4756 |
1118.5378 | 5587.6526 | 5587.6623 | -1.74 | 0 | 1 | 1.7 | 1Score > 16 indicates identity |
HFVPVGEYQGQLFGDSSVSPLANYVSQEEWASIISDINGLLAAAYNPVQFR + 5 Deamidated (NQ) |
| 4241 |
813.7852 | 2438.3338 | 2438.3090 | 10.2 | 1 | 1 | 1.6 | 1Score > 16 indicates identity |
LESLGVIPDTMATLAPKAEVNLR + Deamidated (NQ) |
| 1216 |
830.3930 | 829.3857 | 829.3930 | -8.72 | 0 | 1 | 1.5 | 1Score > 16 indicates identity |
SLNQPNR + 2 Deamidated (NQ) |
| 4089 |
754.7054 | 2261.0944 | 2261.0782 | 7.17 | 0 | 1 | 0.77 | 1Score > 21 indicates identity Score > 13 indicates homology |
LLFMALNDEVFAIQMEAMK + 3 Oxidation (M) |
| 2674 |
604.3069 | 1206.5992 | 1206.5914 | 6.49 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
MDNLKLQDSK + Oxidation (M) |
| 3054 |
506.2484 | 1515.7234 | 1515.7165 | 4.52 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
NQQQSTGTGNGVVPK + 2 Deamidated (NQ) |
| 2885 |
701.3397 | 1400.6648 | 1400.6684 | -2.57 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
FGAPQDLQPGQSR + Deamidated (NQ) |
| 2776 |
644.2968 | 1286.5790 | 1286.5747 | 3.37 | 1 | 1 | 2.7 | 1Score > 18 indicates identity |
YLECSAKMNR + Oxidation (M) |
| 1665 |
968.4799 | 967.4726 | 967.4909 | -18.9 | 1 | 1 | 3.4 | 1Score > 19 indicates identity |
MVYAANKR + Oxidation (M) |
| 4587 |
1064.8428 | 3191.5066 | 3191.5544 | -15.0 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
HVTTLISMDDLSENELKSINDNFLTNVK + 2 Deamidated (NQ) |
| 3366 |
867.3951 | 1732.7756 | 1732.8090 | -19.3 | 1 | 1 | 3 | 1Score > 19 indicates identity |
WCRLASELTDPEEK |
| 2942 |
723.8749 | 1445.7352 | 1445.7548 | -13.5 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
LATSTMNNLIPQK + Oxidation (M) |
| 4641 |
1140.5413 | 3418.6021 | 3418.6498 | -14.0 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
QNLEHTILMLKAMGINDLLNFEFMDPPPK + 2 Deamidated (NQ); 3 Oxidation (M) |
| 1060 |
371.7096 | 741.4046 | 741.3956 | 12.2 | 1 | 1 | 1.4 | 1Score > 15 indicates identity |
KHICGK |
| 2414 |
571.7631 | 1141.5116 | 1141.5186 | -6.09 | 0 | 1 | 2.4 | 1Score > 18 indicates identity |
HNVDNAMTPK + Oxidation (M) |
| 1058 |
742.4113 | 741.4040 | 741.4021 | 2.60 | 0 | 1 | 1.4 | 1Score > 15 indicates identity |
VPSQSPK |
| 1252 |
844.4264 | 843.4191 | 843.4338 | -17.4 | 0 | 1 | 3.2 | 1Score > 19 indicates identity |
NDSGLPLK + Deamidated (NQ) |
| 3759 |
1029.4778 | 2056.9410 | 2056.9346 | 3.13 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
DNAANMKDYLITMWESR |
| 828 |
586.2842 | 585.2769 | 585.2870 | -17.3 | 0 | 1 | 1.2 | 1Score > 15 indicates identity |
ANPQR + Deamidated (NQ) |
| 2170 |
541.2631 | 1080.5116 | 1080.5200 | -7.69 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
ANNPQHGITK + 2 Deamidated (NQ) |
| 1342 |
440.2571 | 878.4996 | 878.5086 | -10.2 | 0 | 1 | 2.4 | 1Score > 18 indicates identity |
GAHVAVGLR |
| 2712 |
618.8149 | 1235.6152 | 1235.5994 | 12.9 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
ALKTEGGSGDSSK |
| 1283 |
857.4203 | 856.4130 | 856.4290 | -18.7 | 0 | 1 | 3.1 | 1Score > 19 indicates identity |
QDPAGEIK |
| 3578 |
960.4537 | 1918.8928 | 1918.8917 | 0.62 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
GLHLNEDIYAGMNAMLR + 2 Deamidated (NQ) |
| 1170 |
800.4280 | 799.4207 | 799.4300 | -11.6 | 0 | 1 | 2.7 | 1Score > 18 indicates identity |
NAQQAIR |
| 2952 |
724.3734 | 1446.7322 | 1446.7388 | -4.53 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
LATSTMNNLIPQK + Deamidated (NQ); Oxidation (M) |
| 2967 |
487.2389 | 1458.6949 | 1458.6660 | 19.8 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
ALNMTSSALSEYR + Deamidated (NQ); Oxidation (M) |
| 2524 |
582.8063 | 1163.5980 | 1163.5791 | 16.3 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
RCQAIGLMSK + Deamidated (NQ) |
| 3632 |
656.0320 | 1965.0742 | 1965.0571 | 8.70 | 1 | 1 | 1.8 | 1Score > 16 indicates identity |
AWDAIAKQLAPSNPLELK + Deamidated (NQ) |
| 3672 |
664.6440 | 1990.9102 | 1990.9484 | -19.2 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
TLPDNDANATIVDDFVSGK |
| 2644 |
1190.5708 | 1189.5635 | 1189.5575 | 5.09 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
SATQQQQQLR + 3 Deamidated (NQ) |
| 1783 |
997.4606 | 996.4533 | 996.4400 | 13.4 | 0 | 1 | 3.4 | 1Score > 19 indicates identity |
SEGDSFIDK |
| 4280 |
830.4541 | 2488.3405 | 2488.2957 | 18.0 | 0 | 1 | 2.4 | 1Score > 17 indicates identity |
MLISLETIHQNISEMYPVLLK + Deamidated (NQ); Oxidation (M) |
| 1459 |
458.2324 | 914.4502 | 914.4392 | 12.1 | 0 | 1 | 2.6 | 1Score > 18 indicates identity |
QSLQMHR + Oxidation (M) |
| 2804 |
660.3364 | 1318.6582 | 1318.6802 | -16.7 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
AMILPTSKEEGK + Oxidation (M) |
| 3282 |
834.3949 | 1666.7752 | 1666.7910 | -9.47 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
LQDLNKEIHNDGNR + 2 Deamidated (NQ) |
| 2854 |
685.3195 | 1368.6244 | 1368.5979 | 19.4 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
KGNEICNNYGAK + 2 Deamidated (NQ) |
| 3104 |
773.8999 | 1545.7852 | 1545.7861 | -0.54 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
VLMNIFSNLEHTK + Deamidated (NQ) |
| 4536 |
756.8776 | 3023.4813 | 3023.4876 | -2.07 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
VNQNLLESHSFINYKQNVEYVNIVR + 4 Deamidated (NQ) |
| 1881 |
1019.4826 | 1018.4753 | 1018.4679 | 7.26 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
DETRNQQK + Deamidated (NQ) |
| 3131 |
781.8963 | 1561.7780 | 1561.7624 | 10.0 | 0 | 1 | 0.95 | 1Score > 22 indicates identity Score > 13 indicates homology |
AELLSFTNNIPEGR + 2 Deamidated (NQ) |
| 4539 |
1010.4532 | 3028.3378 | 3028.3897 | -17.2 | 0 | 1 | 3.5 | 1Score > 19 indicates identity |
ALQDSSSAHATNNSYLSQGSSLTIQFGNK + 3 Deamidated (NQ) |
| 3630 |
983.4482 | 1964.8818 | 1964.8745 | 3.73 | 1 | 1 | 3.7 | 1Score > 19 indicates identity |
MSNNTETDKQVNIGPSGR + 2 Deamidated (NQ); Oxidation (M) |
| 3765 |
1030.5248 | 2059.0350 | 2059.0731 | -18.5 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
MSSVAAAQNKINDLLEAIR + Oxidation (M) |
| 2118 |
1069.5135 | 1068.5062 | 1068.5161 | -9.25 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
EEAMYILGK + Oxidation (M) |
| 1168 |
400.7174 | 799.4202 | 799.4188 | 1.80 | 1 | 1 | 2.8 | 1Score > 18 indicates identity |
LGDPDRK |
| 1378 |
446.2252 | 890.4358 | 890.4531 | -19.4 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
GLMISGGEK |
| 3392 |
585.2657 | 1752.7753 | 1752.8029 | -15.7 | 1 | 1 | 3.8 | 1Score > 19 indicates identity |
DLDGNKLCAFYNPPK + 2 Deamidated (NQ) |
| 3246 |
818.3850 | 1634.7554 | 1634.7285 | 16.5 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
SANPVPPTNNTNTNGH + Deamidated (NQ) |
| 2260 |
551.2820 | 1100.5494 | 1100.5713 | -19.9 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
TINLNPKGDK + 2 Deamidated (NQ) |
| 4705 |
916.9564 | 3663.7965 | 3663.8573 | -16.6 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
GGALLNATNAALHVVENQYLFHSVKDVTTLFYR + 3 Deamidated (NQ) |
| 3093 |
768.8679 | 1535.7212 | 1535.7467 | -16.6 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
AVGDSENIFSAADIK |
| 1733 |
986.4759 | 985.4686 | 985.4828 | -14.4 | 0 | 1 | 2.8 | 1Score > 18 indicates identity |
AEPLATNNR + Deamidated (NQ) |
| 4385 |
689.8419 | 2755.3385 | 2755.3044 | 12.4 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
AMTFSIECELSQNGNIRLLNDSLK + 3 Deamidated (NQ) |
| 2768 |
639.3297 | 1276.6448 | 1276.6333 | 9.06 | 0 | 1 | 0.96 | 1Score > 22 indicates identity Score > 13 indicates homology |
GDILISGNSICK + Deamidated (NQ) |
| 1258 |
848.4064 | 847.3991 | 847.3923 | 8.08 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
SLNEANAK + 2 Deamidated (NQ) |
| 3069 |
509.2592 | 1524.7558 | 1524.7613 | -3.62 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
FFDEAPVLFVEGR |
| 3794 |
1037.5032 | 2072.9918 | 2072.9803 | 5.56 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
LPQGTNVSDYTIPHYDPR + Deamidated (NQ) |
| 3887 |
705.3387 | 2112.9943 | 2112.9885 | 2.74 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
NLEPTIMSLFTGASNAESSK + Deamidated (NQ); Oxidation (M) |
| 1501 |
464.7410 | 927.4674 | 927.4702 | -2.93 | 0 | 1 | 2.7 | 1Score > 18 indicates identity |
YETFLQK |
| 3939 |
1069.0087 | 2136.0028 | 2135.9840 | 8.81 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
SNQSMIINRNNCVIWDR + Deamidated (NQ); Oxidation (M) |
| 4285 |
834.0410 | 2499.1012 | 2499.1322 | -12.4 | 1 | 1 | 3.4 | 1Score > 19 indicates identity |
KNSEVESPSLINTSDMAFEQGSK + 2 Deamidated (NQ) |
| 4372 |
912.4583 | 2734.3531 | 2734.3128 | 14.7 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
QIVARNSQLTLCGMMVQYFNSLK + 2 Deamidated (NQ); 2 Oxidation (M) |
| 1758 |
496.7443 | 991.4740 | 991.4644 | 9.71 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
NNLMIADGK + Deamidated (NQ); Oxidation (M) |
| 1118 |
778.3750 | 777.3677 | 777.3657 | 2.59 | 0 | 1 | 0.98 | 1Score > 20 indicates identity Score > 13 indicates homology |
NGSPFQK + Deamidated (NQ) |
| 4733 |
1127.3445 | 4505.3489 | 4505.3560 | -1.58 | 1 | 1 | 0.85 | 1Score > 13 indicates identity |
AFAYMYMAIVLTSLLVLNYSLAMVMGVLAFPMTRTTTILK + 3 Oxidation (M) |
| 3077 |
765.9110 | 1529.8074 | 1529.8300 | -14.8 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
NLLDNTTLQIEKK + Deamidated (NQ) |
| 4674 |
1165.5756 | 3493.7050 | 3493.7733 | -19.6 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
KVFFSVMLGLGLPLLFTMTLASAAMACTQTNK + Deamidated (NQ); 2 Oxidation (M) |
| 3140 |
782.8708 | 1563.7270 | 1563.7416 | -9.32 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
QEIQRGSPYEDIK + 2 Deamidated (NQ) |
| 3161 |
792.8664 | 1583.7182 | 1583.7476 | -18.5 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
YALIGDCTMHFLK + Oxidation (M) |
| 1817 |
336.1556 | 1005.4450 | 1005.4259 | 19.0 | 0 | 1 | 2.3 | 1Score > 17 indicates identity |
MHLMQNSK + 2 Deamidated (NQ); Oxidation (M) |
| 4658 |
861.4396 | 3441.7293 | 3441.7378 | -2.46 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
NEALFTTGVMDIKPYSINIIPGEVSFSLDVR + Deamidated (NQ); Oxidation (M) |
| 3323 |
849.4070 | 1696.7994 | 1696.8090 | -5.62 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
NAVEQILLEQHNCK + 2 Deamidated (NQ) |
| 3949 |
715.3611 | 2143.0615 | 2143.0545 | 3.24 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
QVISQSPEGAALQKEWTNR + 2 Deamidated (NQ) |
| 4391 |
922.4780 | 2764.4122 | 2764.3959 | 5.88 | 1 | 1 | 4.1 | 1Score > 19 indicates identity |
QQAAETKELQQIPPQLLFVHWQK + 5 Deamidated (NQ) |
| 2141 |
1076.5073 | 1075.5000 | 1075.5033 | -3.06 | 0 | 1 | 4.2 | 1Score > 20 indicates identity |
EVSQDELGAK + Deamidated (NQ) |
| 2857 |
687.3440 | 1372.6734 | 1372.6582 | 11.1 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
NIEASVQPSRDR + 2 Deamidated (NQ) |
| 4675 |
875.6888 | 3498.7261 | 3498.7213 | 1.38 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
TATIIHLQNSIKELQSQLDVSSSQNDQLEEK + 3 Deamidated (NQ) |
| 3206 |
806.3700 | 1610.7254 | 1610.7293 | -2.41 | 1 | 1 | 4.1 | 1Score > 19 indicates identity |
MECFARDNAVLNR + Oxidation (M) |
| 1454 |
457.2286 | 912.4426 | 912.4263 | 18.0 | 0 | 1 | 3.7 | 1Score > 19 indicates identity |
IFTEEMK + Oxidation (M) |
| 4403 |
929.4742 | 2785.4008 | 2785.4061 | -1.92 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
ILPYDSRDNEIPILEPPSYEPLSK + Deamidated (NQ) |
| 2479 |
578.2640 | 1154.5134 | 1154.5203 | -5.97 | 0 | 1 | 3.4 | 1Score > 18 indicates identity |
NHLNNEGLDK + 2 Deamidated (NQ) |
| 2731 |
625.3372 | 1248.6598 | 1248.6714 | -9.23 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
NKIIESPSFSK |
| 1138 |
393.1941 | 784.3736 | 784.3715 | 2.73 | 0 | 1 | 2.7 | 1Score > 17 indicates identity |
TAAHQEK + Deamidated (NQ) |
| 3631 |
655.9687 | 1964.8843 | 1964.9215 | -18.9 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
SNVDEFDTALDSPSVQIK + Deamidated (NQ) |
| 1478 |
461.7554 | 921.4962 | 921.4920 | 4.65 | 0 | 1 | 0.97 | 1Score > 21 indicates identity Score > 13 indicates homology |
QNQLPPPK + Deamidated (NQ) |
| 1629 |
480.7676 | 959.5206 | 959.5162 | 4.68 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
NHIRQHR |
| 3038 |
755.3407 | 1508.6668 | 1508.6664 | 0.30 | 0 | 1 | 4.2 | 1Score > 19 indicates identity |
MNSNSNLNGILEGK + 3 Deamidated (NQ); Oxidation (M) |
| 3491 |
919.8867 | 1837.7588 | 1837.7709 | -6.58 | 0 | 1 | 1.3 | 1Score > 14 indicates identity |
MEDDLENAGNEAISAMK + Deamidated (NQ) |
| 4726 |
1053.2776 | 4209.0813 | 4209.0003 | 19.2 | 1 | 1 | 3 | 1Score > 18 indicates identity |
MASWDTISCVRLGSALACSQDEILPILLQFHQSISSC + Oxidation (M) |
| 1732 |
493.7312 | 985.4478 | 985.4465 | 1.40 | 0 | 1 | 2.2 | 1Score > 17 indicates identity |
HGQSEVNSK + Deamidated (NQ) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/