MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 2 |
| MS data file | : | PRT1245_Other_P1_B10.mgf |
| Database | : | K-marxianus 20241107 (5,052 sequences; 2,515,027 residues) |
| Timestamp | : | 24 Jun 2025 at 21:29:11 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,780 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 1021 |
361.7016 | 721.3886 | 721.3759 | 17.7 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
FTLDAR |
| 914 |
328.1744 | 654.3342 | 654.3449 | -16.3 | 0 | 3 | 1.3 | 1Score > 17 indicates identity |
IGNSHK |
| 2574 |
588.7809 | 1175.5472 | 1175.5611 | -11.8 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
WAPVNSPNYK + Deamidated (NQ) |
| 2807 |
662.8403 | 1323.6660 | 1323.6459 | 15.2 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
NFLVFQGDVER + Deamidated (NQ) |
| 2693 |
610.3024 | 1218.5902 | 1218.6067 | -13.5 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
MTPLKNNWAK + Deamidated (NQ); Oxidation (M) |
| 1827 |
504.2498 | 1006.4850 | 1006.4832 | 1.87 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
NIQQYNAR + Deamidated (NQ) |
| 1173 |
401.1969 | 800.3792 | 800.3664 | 16.0 | 0 | 3 | 1.2 | 1Score > 16 indicates identity |
NAQEDPK |
| 3138 |
782.4104 | 1562.8062 | 1562.8304 | -15.4 | 1 | 3 | 0.66 | 1Score > 22 indicates identity Score > 14 indicates homology |
LYQQSEQLAVVRK + 2 Deamidated (NQ) |
| 857 |
618.2739 | 617.2666 | 617.2769 | -16.6 | 0 | 3 | 0.74 | 1Score > 14 indicates identity |
QEGER |
| 1194 |
408.6964 | 815.3782 | 815.3773 | 1.12 | 0 | 3 | 1 | 1Score > 16 indicates identity |
NNDPTVR + Deamidated (NQ) |
| 1257 |
848.3794 | 847.3721 | 847.3858 | -16.1 | 0 | 3 | 1.4 | 1Score > 17 indicates identity |
MSEAAAPR + Oxidation (M) |
| 4233 |
809.3663 | 2425.0771 | 2425.1141 | -15.3 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
KGELEEDCEMAGGIIIGQGYEK |
| 1115 |
387.6912 | 773.3678 | 773.3668 | 1.41 | 0 | 3 | 1.6 | 1Score > 17 indicates identity |
QLDNER |
| 3514 |
927.4623 | 1852.9100 | 1852.9418 | -17.1 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
LAGVPQELPQDVKDSQK + 2 Deamidated (NQ) |
| 2045 |
1054.4805 | 1053.4732 | 1053.4615 | 11.2 | 0 | 3 | 1.8 | 1Score > 18 indicates identity |
TDDSFSSAPK |
| 1956 |
518.2064 | 1034.3982 | 1034.3941 | 4.02 | 0 | 3 | 0.52 | 1Score > 13 indicates identity |
QDNNHYDK + 2 Deamidated (NQ) |
| 3267 |
825.8732 | 1649.7318 | 1649.7099 | 13.3 | 0 | 3 | 2.6 | 1Score > 20 indicates identity |
MSQMNTFTMSQALK + Deamidated (NQ); 2 Oxidation (M) |
| 3763 |
687.0266 | 2058.0580 | 2058.0745 | -8.05 | 1 | 3 | 0.83 | 1Score > 21 indicates identity Score > 14 indicates homology |
IGDFGLAKNVQKPQESLGR + 2 Deamidated (NQ) |
| 3767 |
1030.5289 | 2059.0432 | 2059.0731 | -14.5 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
MSSVAAAQNKINDLLEAIR + Oxidation (M) |
| 3438 |
899.9941 | 1797.9736 | 1797.9526 | 11.7 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
FGSVLFGELRNAVFSR |
| 3446 |
903.3924 | 1804.7702 | 1804.7533 | 9.37 | 0 | 3 | 1.2 | 1Score > 16 indicates identity |
ASSQSSSPNTNPHSQMK + 2 Deamidated (NQ); Oxidation (M) |
| 2865 |
692.8527 | 1383.6908 | 1383.6994 | -6.15 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
KNNAAAASPDSLPK + Deamidated (NQ) |
| 3596 |
968.5120 | 1935.0094 | 1935.0425 | -17.1 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
QNIHPVITESAKTELVR + Deamidated (NQ) |
| 4612 |
1097.8180 | 3290.4322 | 3290.4801 | -14.6 | 1 | 3 | 1.5 | 1Score > 17 indicates identity |
MVVMNPNNWHWVDKNTLPWTNDYLER + 3 Deamidated (NQ); Oxidation (M) |
| 4450 |
967.4770 | 2899.4092 | 2899.4109 | -0.60 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
QQINAMVLSHWLQDVCGFKPNAAEK + Oxidation (M) |
| 923 |
329.1823 | 656.3500 | 656.3428 | 11.0 | 0 | 3 | 1.4 | 1Score > 17 indicates identity |
MVVHR + Oxidation (M) |
| 1598 |
475.7388 | 949.4630 | 949.4730 | -10.4 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
HNHSTLNK |
| 2579 |
588.8234 | 1175.6322 | 1175.6186 | 11.6 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
QLPNVLNYSK + Deamidated (NQ) |
| 3286 |
834.9963 | 1667.9780 | 1667.9458 | 19.4 | 0 | 3 | 0.56 | 1Score > 13 indicates identity |
SIRPLDVEAIINTVK + Deamidated (NQ) |
| 4040 |
1108.5117 | 2215.0088 | 2215.0141 | -2.38 | 0 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
GINGLQQQQQPSQQYPDQR + 3 Deamidated (NQ) |
| 1256 |
846.4236 | 845.4163 | 845.4065 | 11.6 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
MSAPAPTR + Oxidation (M) |
| 3132 |
521.6004 | 1561.7794 | 1561.7487 | 19.7 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
VYFADEPGMYKVK + Oxidation (M) |
| 2766 |
638.8337 | 1275.6528 | 1275.6347 | 14.3 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
NVGLSETELWK + Deamidated (NQ) |
| 2794 |
655.3245 | 1308.6344 | 1308.6098 | 18.8 | 0 | 3 | 0.77 | 1Score > 21 indicates identity Score > 14 indicates homology |
ANIQNHYYTGK + Deamidated (NQ) |
| 1673 |
485.7467 | 969.4788 | 969.4953 | -17.0 | 0 | 2 | 1.7 | 1Score > 17 indicates identity |
VTNPMPAPK + Oxidation (M) |
| 2739 |
629.8022 | 1257.5898 | 1257.5990 | -7.24 | 0 | 2 | 2.1 | 1Score > 18 indicates identity |
YSSTFLSSNPR |
| 2583 |
589.2988 | 1176.5830 | 1176.5696 | 11.4 | 0 | 2 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
DGINGVEMTLK + Deamidated (NQ) |
| 3059 |
506.9099 | 1517.7079 | 1517.7362 | -18.6 | 0 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
FNAVLENTPSSDPK |
| 801 |
544.3099 | 543.3026 | 543.3129 | -18.9 | 1 | 2 | 1.2 | 1Score > 16 indicates identity |
RSPGK |
| 1406 |
899.4943 | 898.4870 | 898.4985 | -12.7 | 1 | 2 | 1.5 | 1Score > 17 indicates identity |
DASVPRVR |
| 4195 |
787.3704 | 2359.0894 | 2359.0862 | 1.33 | 0 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
MSHEGFQIPTNLDAAAAGAAQSR + Deamidated (NQ); Oxidation (M) |
| 2703 |
613.2924 | 1224.5702 | 1224.5510 | 15.7 | 0 | 2 | 2.9 | 1Score > 19 indicates identity |
ALQDAVNSYDK + 2 Deamidated (NQ) |
| 3850 |
698.9726 | 2093.8960 | 2093.9350 | -18.7 | 0 | 2 | 1.5 | 1Score > 17 indicates identity |
DDIPEEIIQEMDDLYEK |
| 2855 |
685.3445 | 1368.6744 | 1368.6521 | 16.3 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
ATKVSDVQYDSR + Deamidated (NQ) |
| 975 |
342.1960 | 682.3774 | 682.3762 | 1.82 | 0 | 2 | 0.94 | 1Score > 15 indicates identity |
IPSNPR |
| 1655 |
484.2132 | 966.4118 | 966.4117 | 0.16 | 0 | 2 | 1.4 | 1Score > 16 indicates identity |
CDVPFSDK |
| 2680 |
604.8254 | 1207.6362 | 1207.6350 | 1.06 | 0 | 2 | 2.9 | 1Score > 19 indicates identity |
SPLQGFGLFSR |
| 3231 |
543.5922 | 1627.7548 | 1627.7729 | -11.2 | 0 | 2 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
GQEAPNQPFTPAAGLK + 3 Deamidated (NQ) |
| 3680 |
998.4747 | 1994.9348 | 1994.9181 | 8.41 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
RIQEQNNSVEIYSDGNK + 2 Deamidated (NQ) |
| 1495 |
464.7099 | 927.4052 | 927.4120 | -7.30 | 0 | 2 | 1.3 | 1Score > 16 indicates identity |
YDMGTVSR |
| 2480 |
578.2701 | 1154.5256 | 1154.5203 | 4.60 | 0 | 2 | 2.2 | 1Score > 18 indicates identity |
NHLNNEGLDK + 2 Deamidated (NQ) |
| 4479 |
985.8158 | 2954.4256 | 2954.4089 | 5.66 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
SQGMKNGVLAIPGVAFMPGNEQTCYIR + Deamidated (NQ); Oxidation (M) |
| 1337 |
877.4305 | 876.4232 | 876.4341 | -12.4 | 0 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
LSPFEQR + Deamidated (NQ) |
| 3698 |
670.3311 | 2007.9715 | 2007.9935 | -11.0 | 1 | 2 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
VNTNMVSGGGANIGPSFLKK + 2 Deamidated (NQ); Oxidation (M) |
| 934 |
667.3530 | 666.3457 | 666.3561 | -15.6 | 0 | 2 | 1.9 | 1Score > 18 indicates identity |
LNHQR |
| 1042 |
367.1911 | 732.3676 | 732.3806 | -17.7 | 0 | 2 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
ATLWDK |
| 1176 |
802.4332 | 801.4259 | 801.4418 | -19.9 | 0 | 2 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
INMPLAK + Oxidation (M) |
| 1962 |
518.2840 | 1034.5534 | 1034.5556 | -2.07 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
MVHSLHRR |
| 827 |
584.3412 | 583.3339 | 583.3442 | -17.6 | 0 | 2 | 0.6 | 1Score > 13 indicates identity |
VAAPAR |
| 3101 |
514.5887 | 1540.7443 | 1540.7272 | 11.1 | 0 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
YYMDALYAFQLK + Oxidation (M) |
| 3189 |
800.9018 | 1599.7890 | 1599.7675 | 13.5 | 1 | 2 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
RVEHASLPSNSQMK + Deamidated (NQ); Oxidation (M) |
| 3235 |
815.9032 | 1629.7918 | 1629.7861 | 3.53 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
FIVGMEFPNKEFR + Deamidated (NQ); Oxidation (M) |
| 4618 |
1111.5300 | 3331.5682 | 3331.5666 | 0.46 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
SGHEQVVNAKINEYYIVNGCSPLDLEQPR + 3 Deamidated (NQ) |
| 2062 |
1058.4938 | 1057.4865 | 1057.4975 | -10.3 | 1 | 2 | 2 | 1Score > 18 indicates identity |
MNLEHKDR + Oxidation (M) |
| 2676 |
604.8203 | 1207.6260 | 1207.6350 | -7.38 | 0 | 2 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
SPLQGFGLFSR |
| 2104 |
533.7614 | 1065.5082 | 1065.5090 | -0.75 | 1 | 2 | 0.91 | 1Score > 21 indicates identity Score > 14 indicates homology |
LGNTRNNFK + 3 Deamidated (NQ) |
| 973 |
683.3751 | 682.3678 | 682.3762 | -12.3 | 0 | 2 | 1 | 1Score > 15 indicates identity |
TAINHK |
| 2677 |
604.8212 | 1207.6278 | 1207.6350 | -5.89 | 0 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
SPLQGFGLFSR |
| 3867 |
701.3382 | 2100.9928 | 2100.9885 | 2.03 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
NTKNIDLMTVDSNSVTFGK + 2 Deamidated (NQ); Oxidation (M) |
| 1245 |
421.7407 | 841.4668 | 841.4592 | 9.04 | 1 | 2 | 1.8 | 1Score > 17 indicates identity |
VVKHGMR + Oxidation (M) |
| 3129 |
781.8941 | 1561.7736 | 1561.7624 | 7.23 | 0 | 2 | 0.88 | 1Score > 22 indicates identity Score > 14 indicates homology |
AELLSFTNNIPEGR + 2 Deamidated (NQ) |
| 1332 |
875.4996 | 874.4923 | 874.4946 | -2.58 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
MIKELNK |
| 881 |
634.3565 | 633.3492 | 633.3486 | 0.98 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
KDPFK |
| 2512 |
581.8158 | 1161.6170 | 1161.6063 | 9.23 | 0 | 2 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
VMALAAQSNLK + Deamidated (NQ); Oxidation (M) |
| 1272 |
854.4122 | 853.4049 | 853.4156 | -12.5 | 0 | 2 | 2.4 | 1Score > 18 indicates identity |
WMLYNK |
| 3690 |
669.0362 | 2004.0868 | 2004.0527 | 17.0 | 1 | 2 | 2.4 | 1Score > 18 indicates identity |
YINGLIQQDLALDGSQKK + Deamidated (NQ) |
| 2635 |
594.3177 | 1186.6208 | 1186.6194 | 1.26 | 0 | 2 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
VSAEQLQQVGK + Deamidated (NQ) |
| 3856 |
525.2551 | 2096.9913 | 2097.0198 | -13.6 | 1 | 2 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
AQAEAQARVQAQAQAEAQAR + 2 Deamidated (NQ) |
| 3445 |
902.4457 | 1802.8768 | 1802.8759 | 0.54 | 1 | 2 | 0.84 | 1Score > 21 indicates identity Score > 14 indicates homology |
DPRTAESGSGTTQQLVR + Deamidated (NQ) |
| 4362 |
898.7781 | 2693.3125 | 2693.3636 | -19.0 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
SIDTDRFLFMQNPVFQRPPELK + Oxidation (M) |
| 3226 |
812.4371 | 1622.8596 | 1622.8515 | 5.01 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
NYGKTALGTISEELK |
| 1963 |
518.2846 | 1034.5546 | 1034.5556 | -0.91 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
MVHSLHRR |
| 898 |
321.1850 | 640.3554 | 640.3656 | -15.9 | 0 | 2 | 1 | 1Score > 14 indicates identity |
VAAQPR |
| 2663 |
600.2733 | 1198.5320 | 1198.5479 | -13.2 | 0 | 2 | 2.7 | 1Score > 19 indicates identity |
NTHSHHSGPPK + Deamidated (NQ) |
| 1402 |
899.4487 | 898.4414 | 898.4508 | -10.5 | 0 | 2 | 2.1 | 1Score > 18 indicates identity |
NGLNPGEAK |
| 777 |
513.2687 | 512.2614 | 512.2595 | 3.83 | 0 | 2 | 0.67 | 1Score > 13 indicates identity |
GPPDK |
| 3436 |
898.4585 | 1794.9024 | 1794.9186 | -8.98 | 1 | 2 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
VLNVKDFSSIMAELGR + Deamidated (NQ); Oxidation (M) |
| 4628 |
843.4298 | 3369.6901 | 3369.7312 | -12.2 | 1 | 2 | 2.8 | 1Score > 19 indicates identity |
SNILDAICFVLGISSMSTVRAQNLQDLIYK + Deamidated (NQ) |
| 3542 |
940.4294 | 1878.8442 | 1878.8703 | -13.8 | 0 | 2 | 3.1 | 1Score > 19 indicates identity |
MEQVDLVSANMLAAGANK + 2 Deamidated (NQ); Oxidation (M) |
| 4624 |
1123.2041 | 3366.5905 | 3366.5691 | 6.35 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
MMGTNGLPFSSVIAMLNANYMMSRLSSHYK + Oxidation (M) |
| 3615 |
651.3247 | 1950.9523 | 1950.9898 | -19.2 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
KPLGTELAFASEGSKSDSK |
| 833 |
596.3416 | 595.3343 | 595.3442 | -16.6 | 0 | 2 | 1 | 1Score > 14 indicates identity |
LGPGPR |
| 791 |
531.2419 | 530.2346 | 530.2336 | 1.85 | 0 | 2 | 0.69 | 1Score > 13 indicates identity |
GPDDK |
| 1740 |
494.2557 | 986.4968 | 986.4855 | 11.5 | 1 | 2 | 3.3 | 1Score > 19 indicates identity |
KHMQDALK + Deamidated (NQ); Oxidation (M) |
| 1666 |
968.4810 | 967.4737 | 967.4909 | -17.8 | 1 | 2 | 3.2 | 1Score > 19 indicates identity |
MVYAANKR + Oxidation (M) |
| 1117 |
778.3744 | 777.3671 | 777.3691 | -2.50 | 0 | 2 | 0.94 | 1Score > 20 indicates identity Score > 14 indicates homology |
IQNMQK + Deamidated (NQ); Oxidation (M) |
| 1884 |
510.2733 | 1018.5320 | 1018.5342 | -2.09 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
RSLTNCLR |
| 2590 |
1178.5817 | 1177.5744 | 1177.5866 | -10.3 | 0 | 2 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
LEALNLFNNK + 3 Deamidated (NQ) |
| 2675 |
604.8189 | 1207.6232 | 1207.6350 | -9.70 | 0 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
SPLQGFGLFSR |
| 4373 |
912.4688 | 2734.3846 | 2734.3636 | 7.68 | 1 | 2 | 0.95 | 1Score > 20 indicates identity Score > 14 indicates homology |
KFMSVYNPTGAEPIPQNLIINNTR + 2 Deamidated (NQ); Oxidation (M) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/