MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 2 |
| MS data file | : | PRT1245_Other_P1_B10.mgf |
| Database | : | K-marxianus 20241107 (5,052 sequences; 2,515,027 residues) |
| Timestamp | : | 24 Jun 2025 at 21:29:11 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,780 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 1907 |
512.7437 | 1023.4728 | 1023.4543 | 18.2 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
MSNSVSSSPK + Deamidated (NQ) |
| 1204 |
411.7276 | 821.4406 | 821.4317 | 10.9 | 0 | 5 | 0.46 | 1Score > 21 indicates identity Score > 14 indicates homology |
LSQIMSK + Oxidation (M) |
| 1027 |
725.3946 | 724.3873 | 724.3868 | 0.77 | 0 | 5 | 1 | 1Score > 17 indicates identity |
QIAEHK |
| 1068 |
744.3541 | 743.3468 | 743.3562 | -12.6 | 0 | 5 | 0.75 | 1Score > 16 indicates identity |
GAPQTNR + Deamidated (NQ) |
| 963 |
341.1880 | 680.3614 | 680.3493 | 17.8 | 1 | 5 | 0.99 | 1Score > 17 indicates identity |
QNKYK + Deamidated (NQ) |
| 3699 |
670.3350 | 2007.9832 | 2007.9910 | -3.92 | 1 | 5 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
SRMSVSVFFDCLYILR + Oxidation (M) |
| 3768 |
687.3554 | 2059.0444 | 2059.0731 | -14.0 | 1 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
MSSVAAAQNKINDLLEAIR + Oxidation (M) |
| 2218 |
546.7710 | 1091.5274 | 1091.5207 | 6.19 | 1 | 5 | 0.81 | 1Score > 21 indicates identity Score > 16 indicates homology |
RSSSENIDGK |
| 805 |
554.3060 | 553.2987 | 553.2972 | 2.71 | 0 | 5 | 1.6 | 1Score > 19 indicates identity |
NAPPR |
| 1018 |
721.3158 | 720.3085 | 720.3112 | -3.74 | 0 | 5 | 0.53 | 1Score > 14 indicates identity |
CEGNIK + Deamidated (NQ) |
| 1621 |
478.7368 | 955.4590 | 955.4658 | -7.02 | 1 | 5 | 1.5 | 1Score > 19 indicates identity |
NCEKLHR |
| 2849 |
682.8069 | 1363.5992 | 1363.6150 | -11.6 | 1 | 5 | 1.4 | 1Score > 19 indicates identity |
SVGDAMRDLDNR + Oxidation (M) |
| 1157 |
795.4116 | 794.4043 | 794.3923 | 15.2 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
EIDPHGK |
| 2244 |
1098.4812 | 1097.4739 | 1097.4778 | -3.50 | 0 | 4 | 0.93 | 1Score > 17 indicates identity |
FFDEANAER |
| 1502 |
928.4749 | 927.4676 | 927.4702 | -2.74 | 0 | 4 | 1.2 | 1Score > 18 indicates identity |
YETFLQK |
| 787 |
529.2636 | 528.2563 | 528.2656 | -17.5 | 0 | 4 | 0.36 | 1Score > 13 indicates identity |
EGAPR |
| 3547 |
945.4468 | 1888.8790 | 1888.8803 | -0.64 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
SENDYSHKVDVNLGPSK + Deamidated (NQ) |
| 1315 |
434.6971 | 867.3796 | 867.3657 | 16.1 | 0 | 4 | 0.49 | 1Score > 14 indicates identity |
HNNHMAK + Deamidated (NQ); Oxidation (M) |
| 1949 |
516.7789 | 1031.5432 | 1031.5400 | 3.17 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
RGPEYVSPK |
| 4262 |
824.7481 | 2471.2225 | 2471.2552 | -13.2 | 0 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
LSYNMLDTNLNSLNIALLYMR |
| 1556 |
941.4437 | 940.4364 | 940.4362 | 0.20 | 0 | 4 | 1.5 | 1Score > 19 indicates identity |
NGGSHLNNK + Deamidated (NQ) |
| 2921 |
720.8623 | 1439.7100 | 1439.7256 | -10.8 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
LGPNNDNAALEALK + Deamidated (NQ) |
| 4736 |
1145.0789 | 4576.2865 | 4576.2202 | 14.5 | 1 | 4 | 0.89 | 1Score > 16 indicates identity |
EELSNIEEDLLQPNDEMFLLASFLMNFKEITNTVISIMK + 2 Deamidated (NQ); Oxidation (M) |
| 1433 |
906.4468 | 905.4395 | 905.4389 | 0.74 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
LSNERMR + Deamidated (NQ) |
| 2428 |
573.2847 | 1144.5548 | 1144.5724 | -15.3 | 0 | 4 | 0.6 | 1Score > 21 indicates identity Score > 15 indicates homology |
ANQGTGLQDIK + Deamidated (NQ) |
| 2753 |
635.8055 | 1269.5964 | 1269.6023 | -4.63 | 1 | 4 | 1.8 | 1Score > 19 indicates identity |
VSTDCYQRLK + Deamidated (NQ) |
| 1210 |
413.7065 | 825.3984 | 825.4021 | -4.41 | 0 | 4 | 1.4 | 1Score > 18 indicates identity |
ELNFFR + Deamidated (NQ) |
| 1351 |
441.7385 | 881.4624 | 881.4607 | 2.01 | 0 | 4 | 1.4 | 1Score > 18 indicates identity |
QGTHLTPK + Deamidated (NQ) |
| 1428 |
453.7200 | 905.4254 | 905.4137 | 13.0 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
NQANMRR + Deamidated (NQ); Oxidation (M) |
| 2745 |
631.3343 | 1260.6540 | 1260.6574 | -2.69 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
GLNNFINRANK + Deamidated (NQ) |
| 3076 |
765.9091 | 1529.8036 | 1529.8300 | -17.3 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
NLLDNTTLQIEKK + Deamidated (NQ) |
| 922 |
329.1821 | 656.3496 | 656.3428 | 10.4 | 0 | 4 | 0.98 | 1Score > 17 indicates identity |
MVVHR + Oxidation (M) |
| 2756 |
635.8480 | 1269.6814 | 1269.6928 | -8.97 | 1 | 4 | 0.63 | 1Score > 20 indicates identity Score > 15 indicates homology |
IPVATDEEIRK |
| 1419 |
903.4492 | 902.4419 | 902.4246 | 19.2 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
EADHYLR |
| 2097 |
532.7737 | 1063.5328 | 1063.5298 | 2.85 | 0 | 4 | 0.69 | 1Score > 21 indicates identity Score > 15 indicates homology |
QNLIFDGTR + Deamidated (NQ) |
| 3604 |
971.4497 | 1940.8848 | 1940.8673 | 9.04 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
ESIYLMSVENGGVNGNEK + 2 Deamidated (NQ) |
| 4773 |
1044.5227 | 6261.0925 | 6261.1705 | -12.5 | 1 | 4 | 0.53 | 1Score > 14 indicates identity |
CAEQRFTNTVQGLMILCTMCRPFLVCLGLIPQAVLSGLFFIMGIQGIIGNVIIAR + 4 Deamidated (NQ); 3 Oxidation (M) |
| 1367 |
444.2147 | 886.4148 | 886.4032 | 13.1 | 0 | 4 | 1 | 1Score > 17 indicates identity |
TGGPNSEPK + Deamidated (NQ) |
| 3451 |
905.4506 | 1808.8866 | 1808.8680 | 10.3 | 0 | 4 | 0.47 | 1Score > 21 indicates identity Score > 13 indicates homology |
LSDELVEIVNSGDQYK + Deamidated (NQ) |
| 1155 |
794.3926 | 793.3853 | 793.3970 | -14.7 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
NINFSAK + Deamidated (NQ) |
| 927 |
331.1616 | 660.3086 | 660.3078 | 1.21 | 0 | 4 | 0.62 | 1Score > 22 indicates identity Score > 14 indicates homology |
QEQQK + Deamidated (NQ) |
| 1306 |
865.4074 | 864.4001 | 864.4123 | -14.1 | 1 | 4 | 0.69 | 1Score > 20 indicates identity Score > 15 indicates homology |
KEQMSSR |
| 1262 |
425.2094 | 848.4042 | 848.4062 | -2.27 | 1 | 4 | 0.43 | 1Score > 21 indicates identity Score > 13 indicates homology |
KLCNQGK + 2 Deamidated (NQ) |
| 3452 |
906.5016 | 1810.9886 | 1810.9829 | 3.19 | 0 | 4 | 1.6 | 1Score > 19 indicates identity |
HNLLDNVVNVVLYGLK + 2 Deamidated (NQ) |
| 3647 |
987.4800 | 1972.9454 | 1972.9378 | 3.90 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
LSQNDWLNIPEASDITR + 2 Deamidated (NQ) |
| 1581 |
474.2335 | 946.4524 | 946.4356 | 17.8 | 0 | 4 | 0.91 | 1Score > 20 indicates identity Score > 16 indicates homology |
VQESNENK |
| 1426 |
453.2417 | 904.4688 | 904.4688 | 0.041 | 0 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
EGGIMGVVK + Oxidation (M) |
| 1447 |
911.4614 | 910.4541 | 910.4396 | 15.9 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
TSSSFTPGK |
| 3075 |
765.9039 | 1529.7932 | 1529.7824 | 7.07 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
AVLESVGIEVEEEK |
| 3233 |
408.1970 | 1628.7589 | 1628.7716 | -7.78 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
SSEQPLDNIICQPK + Deamidated (NQ) |
| 2429 |
573.2847 | 1144.5548 | 1144.5724 | -15.3 | 1 | 4 | 0.49 | 1Score > 21 indicates identity Score > 13 indicates homology |
NQEQILNKR + 3 Deamidated (NQ) |
| 2813 |
664.8293 | 1327.6440 | 1327.6660 | -16.5 | 0 | 4 | 0.73 | 1Score > 20 indicates identity Score > 15 indicates homology |
TFSENYVLQVK + Deamidated (NQ) |
| 2872 |
695.3854 | 1388.7562 | 1388.7412 | 10.8 | 0 | 4 | 0.83 | 1Score > 20 indicates identity Score > 16 indicates homology |
IFNILGTNQVNR + Deamidated (NQ) |
| 4094 |
756.3768 | 2266.1086 | 2266.1151 | -2.87 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
DQIKDLDNAVNAYLMLVSSR + 2 Deamidated (NQ) |
| 1955 |
517.7682 | 1033.5218 | 1033.5161 | 5.56 | 1 | 4 | 0.63 | 1Score > 21 indicates identity Score > 14 indicates homology |
KPCSRCVK |
| 920 |
328.1928 | 654.3710 | 654.3701 | 1.49 | 0 | 4 | 0.42 | 1Score > 13 indicates identity |
SVPAPGK |
| 2050 |
1054.5170 | 1053.5097 | 1053.5025 | 6.81 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
MSLRFDNR + Oxidation (M) |
| 4007 |
1093.5425 | 2185.0704 | 2185.0395 | 14.2 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
LGDEKYGLSIMISSEGMSPR + Oxidation (M) |
| 1591 |
949.4724 | 948.4651 | 948.4698 | -4.98 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
VAAMSVAQR + Deamidated (NQ); Oxidation (M) |
| 2678 |
604.8243 | 1207.6340 | 1207.6350 | -0.76 | 0 | 4 | 2.1 | 1Score > 20 indicates identity |
SPLQGFGLFSR |
| 4757 |
1118.7423 | 5588.6751 | 5588.6463 | 5.15 | 0 | 4 | 1 | 1Score > 16 indicates identity |
HFVPVGEYQGQLFGDSSVSPLANYVSQEEWASIISDINGLLAAAYNPVQFR + 6 Deamidated (NQ) |
| 2598 |
590.2873 | 1178.5600 | 1178.5642 | -3.49 | 0 | 4 | 0.72 | 1Score > 21 indicates identity Score > 15 indicates homology |
QPSMGPTFGIK + Deamidated (NQ); Oxidation (M) |
| 1093 |
764.3574 | 763.3501 | 763.3534 | -4.30 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
AAVNMNK + Deamidated (NQ); Oxidation (M) |
| 804 |
554.3004 | 553.2931 | 553.2972 | -7.41 | 0 | 4 | 1.7 | 1Score > 18 indicates identity |
NAPPR |
| 2502 |
580.7850 | 1159.5554 | 1159.5543 | 0.98 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
MSPPGLSQEAK + Oxidation (M) |
| 3762 |
1029.4890 | 2056.9634 | 2056.9297 | 16.4 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
DKIPDVNANGNGNVNGASNGK + 3 Deamidated (NQ) |
| 941 |
669.3322 | 668.3249 | 668.3354 | -15.7 | 1 | 4 | 1.9 | 1Score > 19 indicates identity |
KNNHR + Deamidated (NQ) |
| 1409 |
450.7249 | 899.4352 | 899.4348 | 0.45 | 0 | 4 | 1.3 | 1Score > 17 indicates identity |
QNDAVEPK |
| 4693 |
1184.5721 | 3550.6945 | 3550.6798 | 4.14 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
TNALIPINTASNSNSNSASSSALEINGVSFIDPNK + 4 Deamidated (NQ) |
| 1471 |
460.7159 | 919.4172 | 919.3995 | 19.3 | 1 | 4 | 0.58 | 1Score > 20 indicates identity Score > 14 indicates homology |
KDGSGNNAR + 2 Deamidated (NQ) |
| 3094 |
769.3375 | 1536.6604 | 1536.6474 | 8.49 | 1 | 4 | 1.3 | 1Score > 17 indicates identity |
NASLTNQDRNNCK + 3 Deamidated (NQ) |
| 959 |
339.6643 | 677.3140 | 677.3054 | 12.8 | 0 | 3 | 0.51 | 1Score > 21 indicates identity Score > 13 indicates homology |
MSEAPK + Oxidation (M) |
| 1202 |
411.2361 | 820.4576 | 820.4443 | 16.3 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
DVGKQFK |
| 1065 |
372.2067 | 742.3988 | 742.4086 | -13.1 | 1 | 3 | 1.3 | 1Score > 17 indicates identity |
AGRTGPGK |
| 4390 |
922.4689 | 2764.3849 | 2764.3959 | -3.99 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
QQAAETKELQQIPPQLLFVHWQK + 5 Deamidated (NQ) |
| 1017 |
720.3683 | 719.3610 | 719.3602 | 1.13 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
WKGNSK + Deamidated (NQ) |
| 1200 |
820.3843 | 819.3770 | 819.3909 | -16.9 | 1 | 3 | 0.98 | 1Score > 20 indicates identity Score > 16 indicates homology |
KMDAAER |
| 1125 |
781.3943 | 780.3870 | 780.3766 | 13.4 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
TNLYDR |
| 1063 |
743.4058 | 742.3985 | 742.3973 | 1.62 | 1 | 3 | 1.3 | 1Score > 17 indicates identity |
QKNPEK |
| 2386 |
567.7829 | 1133.5512 | 1133.5539 | -2.35 | 0 | 3 | 0.85 | 1Score > 21 indicates identity Score > 15 indicates homology |
AMAHYQGIVK + Deamidated (NQ); Oxidation (M) |
| 3058 |
506.9098 | 1517.7076 | 1517.7362 | -18.8 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
FNAVLENTPSSDPK |
| 1616 |
477.7494 | 953.4842 | 953.4665 | 18.6 | 1 | 3 | 1.8 | 1Score > 18 indicates identity |
KSTTTSNSK + Deamidated (NQ) |
| 1081 |
756.3530 | 755.3457 | 755.3562 | -13.9 | 0 | 3 | 1.4 | 1Score > 17 indicates identity |
NATHQGK + Deamidated (NQ) |
| 2046 |
1054.4807 | 1053.4734 | 1053.4615 | 11.3 | 0 | 3 | 1.7 | 1Score > 18 indicates identity |
TDDSFSSAPK |
| 4707 |
920.7051 | 3678.7913 | 3678.7195 | 19.5 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
FAQDVEAGMVWINSSNDVDINIPFGGVKMSGHGR + 2 Oxidation (M) |
| 3358 |
863.4122 | 1724.8098 | 1724.8403 | -17.6 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
NTMNLLANGNHPGIIK + 3 Deamidated (NQ); Oxidation (M) |
| 3995 |
725.6854 | 2174.0344 | 2174.0267 | 3.53 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
DVTGVSFITDALDDYSQSLK + Deamidated (NQ) |
| 4220 |
797.4355 | 2389.2847 | 2389.2562 | 11.9 | 1 | 3 | 1.3 | 1Score > 17 indicates identity |
SVYVGNLNILQSIVPNMIRQK + 4 Deamidated (NQ) |
| 2679 |
604.8251 | 1207.6356 | 1207.6350 | 0.57 | 0 | 3 | 2.4 | 1Score > 20 indicates identity |
SPLQGFGLFSR |
| 1183 |
810.3637 | 809.3564 | 809.3555 | 1.12 | 0 | 3 | 1.4 | 1Score > 17 indicates identity |
GEANQYK + Deamidated (NQ) |
| 3556 |
948.4896 | 1894.9646 | 1894.9458 | 9.92 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
GLAMSLGIGDEAGVSALYR + Oxidation (M) |
| 4565 |
1039.4932 | 3115.4578 | 3115.4332 | 7.88 | 0 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
VFCTVEVADYNGIQGIWVTDESNEEIK + Deamidated (NQ) |
| 1448 |
456.2364 | 910.4582 | 910.4760 | -19.5 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
GPIDPSTPK |
| 1822 |
1006.4976 | 1005.4903 | 1005.4913 | -0.97 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
AMDADIAKR + Oxidation (M) |
| 4236 |
608.8110 | 2431.2149 | 2431.2165 | -0.67 | 1 | 3 | 0.87 | 1Score > 21 indicates identity Score > 15 indicates homology |
SYNGAIGVDPDKRPCGTILEAAK |
| 1139 |
393.1982 | 784.3818 | 784.3755 | 8.03 | 0 | 3 | 1.6 | 1Score > 18 indicates identity |
YFSSGPK |
| 3660 |
662.3203 | 1983.9391 | 1983.9061 | 16.6 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
ADESKQEPNVFQTTFNK + 2 Deamidated (NQ) |
| 2604 |
591.2800 | 1180.5454 | 1180.5468 | -1.12 | 0 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
LEIMAQDSMK + Oxidation (M) |
| 4493 |
742.8732 | 2967.4637 | 2967.5077 | -14.8 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
AIPNGETDTWILASKNALSTLSSSYTVK + Deamidated (NQ) |
| 3238 |
816.9009 | 1631.7872 | 1631.7687 | 11.3 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
YIQSSHVMMKFTK + Deamidated (NQ); 2 Oxidation (M) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/