MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1245_Other_P1_B9.mgf
Database : K-marxianus 20241107 (5,052 sequences; 2,515,027 residues)
Timestamp : 24 Jun 2025 at 21:28:59 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,728

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 501–600 (out of 4691)


Page: Previous 1 2 3 4 5 6 7 8 9 10 11  47 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4341 955.4796 2863.4170 2863.4127 1.51 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
SLEHLKDISAFVINQSEYEELIER + 2 Deamidated (NQ)
2694 611.8126 1221.6106 1221.5911 16.0 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
DTMDVANILSK + Oxidation (M)
1271 371.1807 740.3468 740.3453 2.08 0 1 1.7 +1Score > 16 indicates identity GIDHNGK + Deamidated (NQ)
2425 1134.5414 1133.5341 1133.5175 14.7 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
CNQGLNLWK + 2 Deamidated (NQ)
875 458.2993 457.2920 457.2900 4.34 0 1 2 +1Score > 16 indicates identity GIAVV
3715 683.0203 2046.0391 2046.0606 -10.5 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
LRLNNHGAAPLTDGIVNDR + Deamidated (NQ)
2455 571.7637 1141.5128 1141.5186 -5.04 0 1 2.8 +1Score > 18 indicates identity HNVDNAMTPK + Oxidation (M)
2714 621.3268 1240.6390 1240.6411 -1.69 0 1 3.9 +1Score > 19 indicates identity SGHSLTLLGNNK + Deamidated (NQ)
2756 645.3633 1288.7120 1288.7312 -14.9 0 1 3.6 +1Score > 19 indicates identity LEVLIQVLSMK + Deamidated (NQ); Oxidation (M)
1069 624.3376 623.3303 623.3391 -14.1 0 1 3.2 +1Score > 18 indicates identity ATAPHK
1079 630.3282 629.3209 629.3133 12.2 0 1 1.1 +1Score > 13 indicates identity APNTAR + Deamidated (NQ)
2664 601.2974 1200.5802 1200.6026 -18.6 0 1 3.8 +1Score > 19 indicates identity WLLDNSPEVK + Deamidated (NQ)
3768 692.3657 2074.0753 2074.0542 10.1 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
LSAPGGVAASVSGSVSGSASAVEK
4348 959.8394 2876.4964 2876.4875 3.10 1 1 2.5 +1Score > 17 indicates identity GLDKTVMAQILTQALAMTINQVTQAAK + 3 Deamidated (NQ); Oxidation (M)
1622 911.3922 910.3849 910.3888 -4.25 1 1 1.7 +1Score > 15 indicates identity MMKQNNK + 2 Deamidated (NQ); Oxidation (M)
2324 1106.5864 1105.5791 1105.5914 -11.1 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
TAALISKSCR
3177 814.3964 1626.7782 1626.7889 -6.56 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
VANDYPNLLLHDDK + Deamidated (NQ)
3184 544.6077 1630.8013 1630.8090 -4.73 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
VTALVNWVQQTLAAN + 4 Deamidated (NQ)
3544 970.4464 1938.8782 1938.8782 0.038 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
GEPFDSNAITPGTEFMAR
4172 839.4235 2515.2487 2515.2053 17.3 1 1 0.94 +1Score > 21 indicates identity
Score > 13 indicates homology
YSLQARIGNMDGIFVAYHNISK + 3 Deamidated (NQ); Oxidation (M)
4615 1079.8051 4315.1913 4315.2272 -8.33 1 1 2.7 +1Score > 17 indicates identity LGFLVEFISLNAVAGFMTGSAINIVAGQVPALMGYGKAVNTR + 3 Deamidated (NQ); Oxidation (M)
2675 605.8099 1209.6052 1209.5812 19.9 0 1 0.96 +1Score > 20 indicates identity
Score > 13 indicates homology
NALSQLNMFR + Deamidated (NQ); Oxidation (M)
2301 552.2564 1102.4982 1102.5077 -8.56 0 1 3.4 +1Score > 18 indicates identity CNPNTEVLR + Deamidated (NQ)
4265 690.3364 2757.3165 2757.3266 -3.65 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
EAAEQPNLKEIEQTALDELCDVLK + 2 Deamidated (NQ)
3434 612.9583 1835.8531 1835.8623 -5.01 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
SVQHGQGNSRGNGNGLPR + 2 Deamidated (NQ)
2318 553.2885 1104.5624 1104.5564 5.51 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
KVAADPSFDR
2653 1193.5535 1192.5462 1192.5320 11.9 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
SSNQSNLNDSK
2755 645.3228 1288.6310 1288.6411 -7.82 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
VYNNLLPEGNR + Deamidated (NQ)
2849 695.8738 1389.7330 1389.7537 -14.9 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
QGVIQLSMIEKK + Deamidated (NQ); Oxidation (M)
3938 1096.5706 2191.1266 2191.1671 -18.5 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
VSIPHACEVLASTQVTIPLR + Deamidated (NQ)
4716 964.6261 6745.3318 6745.3394 -1.13 1 0 0.9 +1Score > 13 indicates identity LLVGQAGNQFGFDLENVAGLHLKPNVVTELDTDWQSMAQEELCVPLPGSALENVLIMPPRR + 4 Deamidated (NQ); Oxidation (M)
3442 921.9371 1841.8596 1841.8755 -8.61 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
GLPPSREEDTQELQSR + Deamidated (NQ)
1515 433.2074 864.4002 864.4011 -0.99 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MDAQGLSK + Oxidation (M)
1586 448.7464 895.4782 895.4837 -6.11 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
LTSFMGLK
3797 695.6726 2083.9960 2083.9918 2.01 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
TMEIYAAMVDELDKNIGR + Oxidation (M)
2747 639.3314 1276.6482 1276.6333 11.7 0 0 0.95 +1Score > 22 indicates identity
Score > 13 indicates homology
GDILISGNSICK + Deamidated (NQ)
3879 1068.5300 2135.0454 2135.0582 -5.96 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
IISNQPDWNMKHVPNVSR + Deamidated (NQ)
4543 1165.5751 3493.7035 3493.7733 -20.0 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
KVFFSVMLGLGLPLLFTMTLASAAMACTQTNK + Deamidated (NQ); 2 Oxidation (M)
1810 968.4678 967.4605 967.4467 14.3 0 0 4.4 +1Score > 19 indicates identity GGATMMLGSK + Oxidation (M)
4547 1175.5701 3523.6885 3523.6608 7.85 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
IWAVTVSFGCVNSLISMPCKMSHASIDPEVR + Deamidated (NQ); 2 Oxidation (M)
4565 906.7416 3622.9373 3622.9895 -14.4 0 0 1 +1Score > 13 indicates identity GGNLLWAVTTSALLLGVPLSLSILAEQQLIEMEK + Oxidation (M)
3251 840.8804 1679.7462 1679.7746 -16.9 1 0 4.5 +1Score > 19 indicates identity IGGKEMIIDSENNMK + 2 Deamidated (NQ)
4710 964.4753 6744.2762 6744.3554 -11.7 1 0 1.3 +1Score > 14 indicates identity LLVGQAGNQFGFDLENVAGLHLKPNVVTELDTDWQSMAQEELCVPLPGSALENVLIMPPRR + 3 Deamidated (NQ); Oxidation (M)
3813 525.2551 2096.9913 2097.0198 -13.6 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
AQAEAQARVQAQAQAEAQAR + 2 Deamidated (NQ)
2558 1164.6124 1163.6051 1163.6121 -6.00 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
MVSIAINGFGR
2891 717.3140 1432.6134 1432.5953 12.7 0 0 1.8 +1Score > 16 indicates identity QQQAQAQAEAQAR + 6 Deamidated (NQ)
2841 692.8538 1383.6930 1383.6882 3.54 1 0 0.92 +1Score > 20 indicates identity
Score > 13 indicates homology
KEGTPSLAADQVPA + Deamidated (NQ)
3532 964.9783 1927.9420 1927.9350 3.68 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
GGSVLQLQYDLTYPMAR + Deamidated (NQ); Oxidation (M)
4253 915.1449 2742.4129 2742.4626 -18.1 0 0 4.2 +1Score > 19 indicates identity MSLPLYRPLETVSLDNAIEDLVVR
1945 504.2640 1006.5134 1006.5335 -19.9 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
VSGILFENK + Deamidated (NQ)
2057 518.2849 1034.5552 1034.5556 -0.33 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MVHSLHRR
2740 636.3233 1270.6320 1270.6557 -18.6 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
FQPLPEAAIER + Deamidated (NQ)
1828 488.2698 974.5250 974.5396 -15.0 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
ALSKVSDQK
2433 1135.5464 1134.5391 1134.5379 1.04 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
TPAPVNDFMK + Oxidation (M)
3187 816.9010 1631.7874 1631.7687 11.5 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
YIQSSHVMMKFTK + Deamidated (NQ); 2 Oxidation (M)
961 530.3213 529.3140 529.3112 5.42 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology
IGLVE
3983 1120.5099 2239.0052 2239.0467 -18.5 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
ALGDEEAALAMFSGWSGVDIGK + Oxidation (M)
4648 997.7159 4983.5431 4983.5137 5.91 1 0 2 +1Score > 16 indicates identity IDNLIVTCKTYQTADALRPFLPYLDNNSNIIMIQNGLGVSEVLK + 4 Deamidated (NQ); Oxidation (M)
2741 636.3235 1270.6324 1270.6292 2.55 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
LLQDEQLPNAK + 3 Deamidated (NQ)
4526 1140.5375 3418.5907 3418.6497 -17.3 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MFELSAQLVGHTQDVRNVVAMNESQLASVSR + 3 Deamidated (NQ)
1194 696.3326 695.3253 695.3126 18.3 0 0 4.7 +1Score > 19 indicates identity QEYEK
2869 704.3325 1406.6504 1406.6525 -1.43 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
KQENTLNNSTEK + 2 Deamidated (NQ)
1173 684.4174 683.4101 683.4218 -17.0 0 0 1.7 +1Score > 15 indicates identity VPVLQK + Deamidated (NQ)
1626 456.2333 910.4520 910.4620 -11.0 1 0 4.3 +1Score > 19 indicates identity RQNLNHK + 2 Deamidated (NQ)
1936 1004.4662 1003.4589 1003.4757 -16.7 0 0 3.1 +1Score > 18 indicates identity MSASGALSHK + Oxidation (M)
1933 501.7631 1001.5116 1001.4964 15.2 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
QGVPMNSLR + Deamidated (NQ)
4162 830.4516 2488.3330 2488.2957 15.0 0 0 3.3 +1Score > 18 indicates identity MLISLETIHQNISEMYPVLLK + Deamidated (NQ); Oxidation (M)
3279 568.6171 1702.8295 1702.8560 -15.6 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
NDIQMDLGVVNLSLR + Deamidated (NQ); Oxidation (M)
1231 720.3697 719.3624 719.3602 3.07 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
WKGNSK + Deamidated (NQ)
3641 1001.4717 2000.9288 2000.8932 17.8 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
AMDPNTDIHETMQVVQR + Deamidated (NQ); Oxidation (M)
3364 881.4230 1760.8314 1760.8224 5.16 1 0 0.97 +1Score > 21 indicates identity
Score > 13 indicates homology
NSLRVTSPSGNNMNNR + Deamidated (NQ)
3381 592.9563 1775.8471 1775.8440 1.73 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
YMDVLSLNNTPYAFK + Deamidated (NQ)
4136 813.7839 2438.3299 2438.2991 12.6 1 0 2.3 +1Score > 16 indicates identity LVNNRIEIEAFIPQLMPGVQR + 2 Deamidated (NQ)
4690 1124.7483 5618.7051 5618.6551 8.90 1 0 2.3 +1Score > 16 indicates identity EVSLNNVIEEVETSMVISVFQDVAEMLRLFGPIIIMDNGNSTQLDQLCR + 5 Deamidated (NQ); 3 Oxidation (M)
1576 891.4562 890.4489 890.4345 16.2 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
LDSNTNVK + Deamidated (NQ)
3060 514.5897 1540.7473 1540.7166 19.9 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
MIRWMIEPDYR + 2 Oxidation (M)
3881 1068.9869 2135.9592 2135.9616 -1.10 0 0 4.3 +1Score > 19 indicates identity EEDQGFPVLMGGPLSNGMAR + 2 Oxidation (M)
3433 918.9261 1835.8376 1835.8333 2.39 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
HATQPDSNNGSNAMHKK
2062 519.7476 1037.4806 1037.4713 9.04 0 0 4 +1Score > 19 indicates identity AVAHHTDCK
1213 705.3203 704.3130 704.3129 0.12 0 0 2.2 +1Score > 16 indicates identity QDWEK
3482 940.4330 1878.8514 1878.8703 -10.0 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MEQVDLVSANMLAAGANK + 2 Deamidated (NQ); Oxidation (M)
4359 967.4772 2899.4098 2899.4109 -0.39 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
QQINAMVLSHWLQDVCGFKPNAAEK + Oxidation (M)
4385 982.4821 2944.4245 2944.4240 0.16 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
MPMPNPMAKATPMAITIPIEKPMETR + Deamidated (NQ); 3 Oxidation (M)
1374 400.7195 799.4244 799.4188 7.06 1 0 2.7 +1Score > 17 indicates identity LGDPDRK
2584 585.8069 1169.5992 1169.6081 -7.54 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
PPKFDPNEVK
4712 964.6178 6745.2737 6745.2426 4.61 1 0 1.3 +1Score > 14 indicates identity DVIQAVTEASNSTSNSSSTSTQPSLLKNCQLKPYQQEGLNWLITLYENGLNGILADEMGLGK + 4 Deamidated (NQ); Oxidation (M)
1834 489.7675 977.5204 977.5069 13.8 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
EYPLLTNK + Deamidated (NQ)
2645 1189.5574 1188.5501 1188.5622 -10.2 0 0 4.6 +1Score > 19 indicates identity LSDGDANVLER + Deamidated (NQ)
4146 822.1097 2463.3073 2463.3335 -10.6 0 0 3.9 +1Score > 19 indicates identity EALLMTGINAIIYTLSTVLPWK + Deamidated (NQ); Oxidation (M)
3011 756.8802 1511.7458 1511.7579 -8.01 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
IENGNQSEPVALKN
2732 635.3273 1268.6400 1268.6513 -8.90 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
HLDANVPFTVR + Deamidated (NQ)
3086 781.9057 1561.7968 1561.7889 5.08 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
VRFDFDVISPPDR
2859 700.8693 1399.7240 1399.7282 -2.96 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
ITTEMKQVHWK
3129 797.3816 1592.7486 1592.7352 8.47 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
NQNAAISASMSSAVPK + 2 Deamidated (NQ); Oxidation (M)
4121 599.3075 2393.2009 2393.2009 0.012 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
SLNFINPTSNLSMNDIRTAIR + Deamidated (NQ); Oxidation (M)
1 300.0932 299.0859
2 300.2090 299.2017
3 301.1166 300.1093
4 301.1428 300.1355
5 301.1435 300.1362
Page: Previous 1 2 3 4 5 6 7 8 9 10 11  47 Next 

Not what you expected? Try the select summary.