MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 1 |
| MS data file | : | PRT1245_Other_P1_B9.mgf |
| Database | : | K-marxianus 20241107 (5,052 sequences; 2,515,027 residues) |
| Timestamp | : | 24 Jun 2025 at 21:28:59 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,728 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 4384 |
982.4807 | 2944.4203 | 2944.4240 | -1.26 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
MPMPNPMAKATPMAITIPIEKPMETR + Deamidated (NQ); 3 Oxidation (M) |
| 1090 |
321.1849 | 640.3552 | 640.3656 | -16.2 | 0 | 2 | 1 | 1Score > 14 indicates identity |
VAAQPR |
| 2157 |
1061.5056 | 1060.4983 | 1060.4897 | 8.12 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
NGSQQQNKR + 2 Deamidated (NQ) |
| 3080 |
781.8938 | 1561.7730 | 1561.7624 | 6.84 | 0 | 2 | 0.89 | 1Score > 22 indicates identity Score > 14 indicates homology |
AELLSFTNNIPEGR + 2 Deamidated (NQ) |
| 1568 |
889.3995 | 888.3922 | 888.4049 | -14.3 | 0 | 2 | 1.2 | 1Score > 15 indicates identity |
QNSEQQR |
| 1990 |
510.2739 | 1018.5332 | 1018.5342 | -0.92 | 1 | 2 | 0.83 | 1Score > 20 indicates identity Score > 13 indicates homology |
RSLTNCLR |
| 2649 |
1190.5712 | 1189.5639 | 1189.5575 | 5.43 | 0 | 2 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
SATQQQQQLR + 3 Deamidated (NQ) |
| 1097 |
644.3317 | 643.3244 | 643.3289 | -6.99 | 0 | 2 | 1.1 | 1Score > 14 indicates identity |
GLNPSR + Deamidated (NQ) |
| 3117 |
794.4167 | 1586.8188 | 1586.8403 | -13.5 | 0 | 2 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
TIAETLAEELINAAK + Deamidated (NQ) |
| 3165 |
810.4099 | 1618.8052 | 1618.7991 | 3.82 | 0 | 2 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
NLITLANYYYSQR + Deamidated (NQ) |
| 2783 |
660.8276 | 1319.6406 | 1319.6568 | -12.3 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
NAVNSKGLVSSNK + 3 Deamidated (NQ) |
| 4224 |
885.4553 | 2653.3441 | 2653.3096 | 13.0 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
GVQHVPNEELIFRIENSSLSNNR + 2 Deamidated (NQ) |
| 1772 |
477.7503 | 953.4860 | 953.5004 | -15.1 | 0 | 1 | 2.8 | 1Score > 19 indicates identity |
VTNPMPAPK |
| 2718 |
626.8150 | 1251.6154 | 1251.6169 | -1.16 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
LEPALGMNTYK + Oxidation (M) |
| 4131 |
809.0316 | 2424.0730 | 2424.1114 | -15.9 | 1 | 1 | 2.6 | 1Score > 18 indicates identity |
HNDENLISKMTAIEEELDHGK + 2 Deamidated (NQ) |
| 1289 |
755.3596 | 754.3523 | 754.3609 | -11.4 | 0 | 1 | 1.8 | 1Score > 16 indicates identity |
QNLNHK + 2 Deamidated (NQ) |
| 1485 |
426.2360 | 850.4574 | 850.4661 | -10.2 | 1 | 1 | 0.99 | 1Score > 20 indicates identity Score > 14 indicates homology |
RTGVSFGK |
| 2914 |
723.8739 | 1445.7332 | 1445.7548 | -14.9 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
LAAMVNNEAKLQK + Deamidated (NQ); Oxidation (M) |
| 4525 |
1136.5536 | 3406.6390 | 3406.5825 | 16.6 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
QIVEQMCNAGHELAAIFMSGGQCRNGLLMR + Oxidation (M) |
| 3079 |
778.8474 | 1555.6802 | 1555.6611 | 12.3 | 1 | 1 | 2.5 | 1Score > 18 indicates identity |
NGNGNGGRTDDHDVK + Deamidated (NQ) |
| 958 |
529.2632 | 528.2559 | 528.2656 | -18.3 | 0 | 1 | 0.72 | 1Score > 13 indicates identity |
NNGPK |
| 1616 |
454.7312 | 907.4478 | 907.4399 | 8.73 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
NASFVNVR + 2 Deamidated (NQ) |
| 2850 |
695.8749 | 1389.7352 | 1389.7537 | -13.3 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
QGVIQLSMIEKK + Deamidated (NQ); Oxidation (M) |
| 2453 |
571.3064 | 1140.5982 | 1140.5775 | 18.2 | 1 | 1 | 3.3 | 1Score > 19 indicates identity |
DISHLDNAKK + Deamidated (NQ) |
| 1400 |
814.5010 | 813.4937 | 813.4960 | -2.76 | 0 | 1 | 3.1 | 1Score > 19 indicates identity |
ELLAQLK |
| 1405 |
820.4280 | 819.4207 | 819.4338 | -15.9 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
SKDELTK |
| 1321 |
386.2254 | 770.4362 | 770.4286 | 9.90 | 1 | 1 | 1.7 | 1Score > 16 indicates identity |
IPEEKR |
| 2834 |
690.3298 | 1378.6450 | 1378.6286 | 12.0 | 0 | 1 | 0.83 | 1Score > 20 indicates identity Score > 13 indicates homology |
LSNQMGTGVNINK + 4 Deamidated (NQ) |
| 2470 |
573.3130 | 1144.6114 | 1144.6088 | 2.34 | 1 | 1 | 0.77 | 1Score > 22 indicates identity Score > 13 indicates homology |
QKTENIINGK + Deamidated (NQ) |
| 4041 |
1151.5695 | 2301.1244 | 2301.1131 | 4.94 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
GNNNINAKINGNNTLTNMINR + 2 Deamidated (NQ) |
| 3990 |
750.3734 | 2248.0984 | 2248.0762 | 9.87 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
MNETLMQQQRELQMALQR + Deamidated (NQ) |
| 2673 |
604.8187 | 1207.6228 | 1207.6350 | -10.0 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
SPLQGFGLFSR |
| 3924 |
725.0399 | 2172.0979 | 2172.0918 | 2.78 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
IVNHMIIDSLNEMQIKNK + Deamidated (NQ); 2 Oxidation (M) |
| 2861 |
701.3397 | 1400.6648 | 1400.6684 | -2.57 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
FGAPQDLQPGQSR + Deamidated (NQ) |
| 2036 |
516.2873 | 1030.5600 | 1030.5481 | 11.6 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
APLNDVMKK + Oxidation (M) |
| 1932 |
501.7626 | 1001.5106 | 1001.4964 | 14.2 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
QGVPMNSLR + Deamidated (NQ) |
| 2894 |
717.3577 | 1432.7008 | 1432.6908 | 7.00 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
SVDKTFSMFLDK + Oxidation (M) |
| 1435 |
833.4102 | 832.4029 | 832.4079 | -5.99 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
DPAFLDR |
| 4546 |
1175.5660 | 3523.6762 | 3523.7062 | -8.52 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
ATNQPVLQTIQSTELTPLTLTMANDNRFMQK + 4 Deamidated (NQ); Oxidation (M) |
| 1147 |
671.4226 | 670.4153 | 670.4126 | 4.07 | 0 | 1 | 1.8 | 1Score > 16 indicates identity |
VLNAVR |
| 3389 |
892.9363 | 1783.8580 | 1783.8736 | -8.70 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
LAAMLDYNLEMLVGSK + Deamidated (NQ); Oxidation (M) |
| 1434 |
417.2085 | 832.4024 | 832.4187 | -19.5 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
LMPMTPK + Oxidation (M) |
| 2173 |
533.2672 | 1064.5198 | 1064.5026 | 16.2 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
DYENVSLPK + Deamidated (NQ) |
| 3035 |
509.2599 | 1524.7579 | 1524.7613 | -2.24 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
FFDEAPVLFVEGR |
| 4536 |
1144.5928 | 3430.7566 | 3430.7974 | -11.9 | 0 | 1 | 3.4 | 1Score > 19 indicates identity |
LAQIQFWLIFVGANVIFLPMHFLGVNGMPR + 3 Deamidated (NQ) |
| 1610 |
453.7198 | 905.4250 | 905.4137 | 12.5 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
NQANMRR + Deamidated (NQ); Oxidation (M) |
| 4494 |
1090.1932 | 3267.5578 | 3267.5558 | 0.60 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
QGQHIFNFPHEESGAQQNQLQQKQQYR |
| 2519 |
385.5410 | 1153.6012 | 1153.6091 | -6.89 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
ANVVPGTNKPR + 2 Deamidated (NQ) |
| 3131 |
797.3892 | 1592.7638 | 1592.7360 | 17.5 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
TKAEMNMLMNLHK + Deamidated (NQ); 2 Oxidation (M) |
| 2889 |
716.8205 | 1431.6264 | 1431.6113 | 10.6 | 0 | 1 | 2.1 | 1Score > 17 indicates identity |
QQQAQAQAEAQAR + 5 Deamidated (NQ) |
| 4232 |
898.4481 | 2692.3225 | 2692.3151 | 2.73 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
LSTPQRNNLSASTSSSTLSTGDNKPK + 2 Deamidated (NQ) |
| 3931 |
726.3973 | 2176.1701 | 2176.1602 | 4.53 | 1 | 1 | 2.5 | 1Score > 18 indicates identity |
DIVLDAFLPIAFRVTPMDK + Oxidation (M) |
| 1440 |
835.4360 | 834.4287 | 834.4388 | -12.1 | 0 | 1 | 0.87 | 1Score > 21 indicates identity Score > 13 indicates homology |
GWIQGFK |
| 3602 |
661.9889 | 1982.9449 | 1982.9692 | -12.3 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
MNQEIMSLSNILIYEGK + Deamidated (NQ) |
| 4289 |
931.1840 | 2790.5302 | 2790.4843 | 16.4 | 1 | 1 | 1.4 | 1Score > 15 indicates identity |
GSVPVYWAELNNLKYKPQLLLSEK + 2 Deamidated (NQ) |
| 4250 |
912.7610 | 2735.2612 | 2735.3007 | -14.4 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
YVSIEACATMGVVSNVDHQNRSLGK + Deamidated (NQ) |
| 1177 |
685.3902 | 684.3829 | 684.3806 | 3.35 | 0 | 1 | 1.3 | 1Score > 15 indicates identity |
ANVPVGK + Deamidated (NQ) |
| 1339 |
784.3488 | 783.3415 | 783.3286 | 16.5 | 0 | 1 | 1.5 | 1Score > 15 indicates identity |
ESEEYK |
| 1145 |
336.2136 | 670.4126 | 670.4014 | 16.8 | 1 | 1 | 3 | 1Score > 18 indicates identity |
AVPKEK |
| 2808 |
671.8506 | 1341.6866 | 1341.7001 | -10.0 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
TVSGGLRGPNVQR + 2 Deamidated (NQ) |
| 3077 |
778.3840 | 1554.7534 | 1554.7388 | 9.42 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
MVWSVYLNELER + Deamidated (NQ); Oxidation (M) |
| 1998 |
511.7451 | 1021.4756 | 1021.4577 | 17.6 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
RGSGPYDDR |
| 4216 |
873.4280 | 2617.2622 | 2617.2768 | -5.58 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
GSMADVPADLMEQIHGLETLFTVK + Oxidation (M) |
| 2532 |
1158.5552 | 1157.5479 | 1157.5313 | 14.4 | 0 | 1 | 3.5 | 1Score > 19 indicates identity |
DSPANQEEIR |
| 3182 |
543.9279 | 1628.7619 | 1628.7538 | 4.97 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
MLGSCYERELLNK + Deamidated (NQ); Oxidation (M) |
| 1291 |
756.3533 | 755.3460 | 755.3562 | -13.5 | 0 | 1 | 2.4 | 1Score > 17 indicates identity |
NATHQGK + Deamidated (NQ) |
| 1146 |
336.2138 | 670.4130 | 670.4014 | 17.4 | 1 | 1 | 3.1 | 1Score > 18 indicates identity |
AVPKEK |
| 1023 |
594.2900 | 593.2827 | 593.2809 | 3.05 | 0 | 1 | 2.2 | 1Score > 17 indicates identity |
GNFQK + Deamidated (NQ) |
| 3410 |
605.2985 | 1812.8737 | 1812.8981 | -13.5 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
LGPNYLHIPVNCPYR + Deamidated (NQ) |
| 1401 |
409.6671 | 817.3196 | 817.3089 | 13.1 | 0 | 1 | 0.81 | 1Score > 13 indicates identity |
NGNGNNPK + 4 Deamidated (NQ) |
| 2408 |
565.2991 | 1128.5836 | 1128.5637 | 17.7 | 0 | 1 | 4 | 1Score > 19 indicates identity |
MLINYYANK |
| 1648 |
460.2502 | 918.4858 | 918.4732 | 13.8 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
ADLMLDIL + Oxidation (M) |
| 2692 |
611.8093 | 1221.6040 | 1221.5877 | 13.4 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
LGGGTYVPDQSK + Deamidated (NQ) |
| 2705 |
615.7855 | 1229.5564 | 1229.5724 | -13.0 | 1 | 1 | 2.6 | 1Score > 17 indicates identity |
GWGCHTSAKAR |
| 1155 |
678.3231 | 677.3158 | 677.3166 | -1.20 | 0 | 1 | 0.97 | 1Score > 21 indicates identity Score > 13 indicates homology |
NQMIR + Deamidated (NQ); Oxidation (M) |
| 1949 |
1008.4860 | 1007.4787 | 1007.4593 | 19.3 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
MASLQAENK + Deamidated (NQ); Oxidation (M) |
| 4095 |
784.7023 | 2351.0851 | 2351.0911 | -2.55 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
AQSISSNGSPLTMNVPASSTTQR + 2 Deamidated (NQ); Oxidation (M) |
| 1503 |
861.4131 | 860.4058 | 860.3988 | 8.18 | 0 | 1 | 3.3 | 1Score > 19 indicates identity |
GLEGGNASR + Deamidated (NQ) |
| 1906 |
498.7434 | 995.4722 | 995.4667 | 5.55 | 0 | 1 | 3.6 | 1Score > 19 indicates identity |
MLEAMELK + 2 Oxidation (M) |
| 4180 |
844.7719 | 2531.2939 | 2531.3358 | -16.6 | 1 | 1 | 3.9 | 1Score > 19 indicates identity |
IVYERIAPALCNLAFVHASYPK |
| 4251 |
912.7921 | 2735.3545 | 2735.3476 | 2.52 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
KFMSVYNPTGAEPIPQNLIINNTR + 3 Deamidated (NQ); Oxidation (M) |
| 2998 |
752.8969 | 1503.7792 | 1503.7528 | 17.6 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
RIQNISNESSINK + 2 Deamidated (NQ) |
| 1717 |
939.4657 | 938.4584 | 938.4644 | -6.34 | 1 | 1 | 4.1 | 1Score > 20 indicates identity |
KVSGNFMR + Deamidated (NQ) |
| 2190 |
535.2612 | 1068.5078 | 1068.5200 | -11.3 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
EPSQAAVDPR |
| 4540 |
861.6827 | 3442.7017 | 3442.7127 | -3.20 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
MSMLAQIKQICIIASVDHIQAPFLWDHFK + 3 Deamidated (NQ) |
| 2817 |
451.8985 | 1352.6737 | 1352.6798 | -4.55 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
EHMEKIYLFK + Oxidation (M) |
| 3436 |
919.8881 | 1837.7616 | 1837.7709 | -5.05 | 0 | 1 | 1.2 | 1Score > 14 indicates identity |
MEDDLENAGNEAISAMK + Deamidated (NQ) |
| 1976 |
508.2662 | 1014.5178 | 1014.5346 | -16.5 | 0 | 1 | 4.1 | 1Score > 19 indicates identity |
IVQNEIDGK |
| 2647 |
1190.5614 | 1189.5541 | 1189.5575 | -2.81 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
SATQQQQQLR + 3 Deamidated (NQ) |
| 3099 |
787.8971 | 1573.7796 | 1573.8100 | -19.3 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
SDPIGIAYLNQNLR + Deamidated (NQ) |
| 2696 |
611.8306 | 1221.6466 | 1221.6353 | 9.28 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
EPGNGHLEKIK + Deamidated (NQ) |
| 1246 |
363.7120 | 725.4094 | 725.4072 | 3.13 | 0 | 1 | 2 | 1Score > 16 indicates identity |
QPSVAPK |
| 1786 |
480.7679 | 959.5212 | 959.5162 | 5.30 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
NHIRQHR |
| 2827 |
687.8698 | 1373.7250 | 1373.7051 | 14.5 | 1 | 1 | 0.88 | 1Score > 21 indicates identity Score > 13 indicates homology |
ESLPVFQNRER |
| 3471 |
623.0381 | 1866.0925 | 1866.0574 | 18.8 | 1 | 1 | 0.84 | 1Score > 13 indicates identity |
VANRLLITGTPLQNNIK + 2 Deamidated (NQ) |
| 1543 |
440.2342 | 878.4538 | 878.4684 | -16.5 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
WIASKMK + Oxidation (M) |
| 2427 |
567.7832 | 1133.5518 | 1133.5452 | 5.88 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
LVTDNSVEEK + Deamidated (NQ) |
| 4386 |
982.8149 | 2945.4229 | 2945.4481 | -8.56 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
GYIIGDSLKHLQLDVPTIQGFDEVQC + Deamidated (NQ) |
| 4458 |
1032.4622 | 3094.3648 | 3094.3199 | 14.5 | 1 | 1 | 3.2 | 1Score > 18 indicates identity |
NNGSSMSPTGLTMGVTMGMGVTKSNSNSNSK + 3 Deamidated (NQ); Oxidation (M) |
| 4513 |
1123.2120 | 3366.6142 | 3366.5691 | 13.4 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
MMGTNGLPFSSVIAMLNANYMMSRLSSHYK + Oxidation (M) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/