MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 1 |
| MS data file | : | PRT1245_Other_P1_B9.mgf |
| Database | : | K-marxianus 20241107 (5,052 sequences; 2,515,027 residues) |
| Timestamp | : | 24 Jun 2025 at 21:28:59 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,728 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 1370 |
800.3824 | 799.3751 | 799.3864 | -14.1 | 0 | 3 | 1.2 | 1Score > 16 indicates identity |
VAEYYR |
| 4338 |
953.4766 | 2857.4080 | 2857.4095 | -0.55 | 1 | 3 | 0.58 | 1Score > 21 indicates identity Score > 13 indicates homology |
VELPEEMGIQDYTIGFAQKQFSVVK + 2 Deamidated (NQ) |
| 1573 |
890.4432 | 889.4359 | 889.4505 | -16.4 | 0 | 3 | 0.56 | 1Score > 22 indicates identity Score > 13 indicates homology |
STVQDIAR + Deamidated (NQ) |
| 3814 |
1050.0021 | 2097.9896 | 2098.0113 | -10.3 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
NQVLVISGPGNNGGDGLVCAR + 2 Deamidated (NQ) |
| 4058 |
770.3903 | 2308.1491 | 2308.1158 | 14.4 | 1 | 3 | 0.59 | 1Score > 21 indicates identity Score > 13 indicates homology |
FSETGSFSSRFVTCVVSGNLK |
| 2368 |
560.7740 | 1119.5334 | 1119.5230 | 9.32 | 0 | 3 | 0.74 | 1Score > 21 indicates identity Score > 14 indicates homology |
SQVLECQQK + Deamidated (NQ) |
| 1290 |
755.3965 | 754.3892 | 754.3973 | -10.7 | 1 | 3 | 1.3 | 1Score > 17 indicates identity |
KDLNHK + Deamidated (NQ) |
| 1475 |
848.3976 | 847.3903 | 847.3858 | 5.34 | 0 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
MSPQDVR + Oxidation (M) |
| 2857 |
700.3724 | 1398.7302 | 1398.7177 | 8.99 | 1 | 3 | 2.4 | 1Score > 19 indicates identity |
NEMSPLKAGVPGAK + Deamidated (NQ) |
| 3212 |
824.9062 | 1647.7978 | 1647.7926 | 3.17 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
TKEMLQFIHEAQR + 2 Deamidated (NQ); Oxidation (M) |
| 1816 |
486.2814 | 970.5482 | 970.5447 | 3.62 | 0 | 3 | 1.8 | 1Score > 18 indicates identity |
NVAVVDINK |
| 1477 |
848.4152 | 847.4079 | 847.4109 | -3.55 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
SLPMQEK + Oxidation (M) |
| 2813 |
674.8338 | 1347.6530 | 1347.6591 | -4.52 | 0 | 3 | 0.55 | 1Score > 21 indicates identity Score > 13 indicates homology |
LLQMELEEAQK + Deamidated (NQ); Oxidation (M) |
| 3645 |
1002.5482 | 2003.0818 | 2003.0761 | 2.86 | 1 | 3 | 2.5 | 1Score > 19 indicates identity |
QAPDFTNKTLVMLANVLK + Deamidated (NQ) |
| 1142 |
669.3336 | 668.3263 | 668.3354 | -13.6 | 1 | 3 | 2.1 | 1Score > 19 indicates identity |
KNNHR + Deamidated (NQ) |
| 1397 |
813.4423 | 812.4350 | 812.4466 | -14.2 | 0 | 3 | 1.4 | 1Score > 17 indicates identity |
MPEPIVK |
| 1504 |
431.2150 | 860.4154 | 860.4239 | -9.86 | 0 | 3 | 0.54 | 1Score > 21 indicates identity Score > 13 indicates homology |
QQEQSLK + Deamidated (NQ) |
| 4052 |
770.0509 | 2307.1309 | 2307.1554 | -10.6 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
QGSTSSNPGSVLASASILSSNKSK + Deamidated (NQ) |
| 1292 |
756.3541 | 755.3468 | 755.3562 | -12.4 | 0 | 3 | 1.4 | 1Score > 17 indicates identity |
NATHQGK + Deamidated (NQ) |
| 2241 |
542.8226 | 1083.6306 | 1083.6288 | 1.69 | 1 | 3 | 1.6 | 1Score > 17 indicates identity |
EVKQGVVPTK |
| 1737 |
472.7437 | 943.4728 | 943.4723 | 0.61 | 0 | 3 | 2.5 | 1Score > 19 indicates identity |
ANVAINQGR + 2 Deamidated (NQ) |
| 3403 |
903.3919 | 1804.7692 | 1804.7533 | 8.81 | 0 | 3 | 1.1 | 1Score > 16 indicates identity |
ASSQSSSPNTNPHSQMK + 2 Deamidated (NQ); Oxidation (M) |
| 3310 |
863.4125 | 1724.8104 | 1724.8403 | -17.3 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
NTMNLLANGNHPGIIK + 3 Deamidated (NQ); Oxidation (M) |
| 3388 |
892.9346 | 1783.8546 | 1783.8529 | 0.96 | 0 | 3 | 0.9 | 1Score > 21 indicates identity Score > 15 indicates homology |
DFFHNNGEGPPLAELK |
| 2349 |
557.2816 | 1112.5486 | 1112.5615 | -11.5 | 0 | 3 | 2.4 | 1Score > 19 indicates identity |
WGVPENGVVR + Deamidated (NQ) |
| 1607 |
905.4769 | 904.4696 | 904.4688 | 0.90 | 0 | 3 | 0.6 | 1Score > 22 indicates identity Score > 13 indicates homology |
EGGIMGVVK + Oxidation (M) |
| 1474 |
848.3811 | 847.3738 | 847.3858 | -14.1 | 0 | 3 | 1.3 | 1Score > 16 indicates identity |
MSEAAAPR + Oxidation (M) |
| 1853 |
982.5602 | 981.5529 | 981.5720 | -19.4 | 1 | 3 | 1 | 1Score > 15 indicates identity |
QRVVLDPR |
| 3966 |
739.6545 | 2215.9417 | 2215.9774 | -16.1 | 0 | 3 | 1.5 | 1Score > 17 indicates identity |
ITCAICPEYDLCVPCFAK |
| 4086 |
781.3718 | 2341.0936 | 2341.1116 | -7.70 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
MIRCLNGMNYVSNDIPVTVK + 2 Deamidated (NQ); Oxidation (M) |
| 3421 |
911.9205 | 1821.8264 | 1821.8493 | -12.5 | 0 | 3 | 2.4 | 1Score > 19 indicates identity |
VQINEAQEQSTAAYNR + Deamidated (NQ) |
| 1585 |
448.7292 | 895.4438 | 895.4442 | -0.34 | 1 | 3 | 0.69 | 1Score > 20 indicates identity Score > 14 indicates homology |
MIKMMSR |
| 2132 |
1054.4810 | 1053.4737 | 1053.4615 | 11.6 | 0 | 3 | 1.9 | 1Score > 18 indicates identity |
TDDSFSSAPK |
| 2489 |
1149.5571 | 1148.5498 | 1148.5309 | 16.5 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
GLGTSTQQEAR + 2 Deamidated (NQ) |
| 907 |
487.2524 | 486.2451 | 486.2438 | 2.74 | 0 | 3 | 0.54 | 1Score > 13 indicates identity |
ANPGK + Deamidated (NQ) |
| 1252 |
730.3386 | 729.3313 | 729.3446 | -18.2 | 0 | 3 | 0.62 | 1Score > 13 indicates identity |
SNPHFK + Deamidated (NQ) |
| 4682 |
1118.5424 | 5587.6756 | 5587.6623 | 2.38 | 0 | 3 | 1.2 | 1Score > 16 indicates identity |
HFVPVGEYQGQLFGDSSVSPLANYVSQEEWASIISDINGLLAAAYNPVQFR + 5 Deamidated (NQ) |
| 1282 |
748.3997 | 747.3924 | 747.3875 | 6.59 | 1 | 3 | 0.91 | 1Score > 20 indicates identity Score > 15 indicates homology |
SNGGSKAK |
| 2687 |
610.3245 | 1218.6344 | 1218.6357 | -1.01 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
TLGTGNSWKVR + Deamidated (NQ) |
| 1021 |
589.2886 | 588.2813 | 588.2867 | -9.19 | 0 | 3 | 2.6 | 1Score > 19 indicates identity |
AVDER |
| 2779 |
659.3273 | 1316.6400 | 1316.6646 | -18.6 | 1 | 3 | 0.76 | 1Score > 20 indicates identity Score > 14 indicates homology |
LMNNIDKGLGPK + 2 Deamidated (NQ); Oxidation (M) |
| 2815 |
676.8782 | 1351.7418 | 1351.7282 | 10.1 | 0 | 3 | 1.6 | 1Score > 17 indicates identity |
LLNQVLMNHIR + 2 Deamidated (NQ) |
| 2736 |
636.2980 | 1270.5814 | 1270.6050 | -18.5 | 0 | 3 | 2.6 | 1Score > 19 indicates identity |
YSLQMQVQMK + Oxidation (M) |
| 4294 |
701.3411 | 2801.3353 | 2801.3793 | -15.7 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
VTKHVQPLSNPAYDVSSELVQNMVK + 3 Deamidated (NQ); Oxidation (M) |
| 3735 |
1030.5262 | 2059.0378 | 2059.0731 | -17.1 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
MSSVAAAQNKINDLLEAIR + Oxidation (M) |
| 2745 |
638.8350 | 1275.6554 | 1275.6347 | 16.3 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
NVGLSETELWK + Deamidated (NQ) |
| 3516 |
638.3242 | 1911.9508 | 1911.9876 | -19.3 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
IMLANHPDKGGSPYLATK |
| 3032 |
762.3604 | 1522.7062 | 1522.6953 | 7.19 | 0 | 2 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
FHQHNFHLENAK + 2 Deamidated (NQ) |
| 2973 |
745.3635 | 1488.7124 | 1488.7321 | -13.2 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
NLREGGNAGFPLSR + 2 Deamidated (NQ) |
| 1924 |
500.7915 | 999.5684 | 999.5713 | -2.81 | 1 | 2 | 0.61 | 1Score > 20 indicates identity Score > 13 indicates homology |
KQNQLQIK + Deamidated (NQ) |
| 4402 |
742.8748 | 2967.4701 | 2967.5077 | -12.7 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
AIPNGETDTWILASKNALSTLSSSYTVK + Deamidated (NQ) |
| 3644 |
668.7007 | 2003.0803 | 2003.0687 | 5.76 | 1 | 2 | 2.7 | 1Score > 19 indicates identity |
YINGLIQQDLALDGSQKK |
| 3585 |
657.3284 | 1968.9634 | 1968.9251 | 19.4 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
MTQYKNPQEFINDLAR + 2 Deamidated (NQ) |
| 980 |
545.2587 | 544.2514 | 544.2493 | 3.93 | 0 | 2 | 0.82 | 1Score > 14 indicates identity |
QGDPK + Deamidated (NQ) |
| 4248 |
912.4641 | 2734.3705 | 2734.3636 | 2.52 | 1 | 2 | 0.79 | 1Score > 21 indicates identity Score > 14 indicates homology |
KFMSVYNPTGAEPIPQNLIINNTR + 2 Deamidated (NQ); Oxidation (M) |
| 2056 |
518.2841 | 1034.5536 | 1034.5556 | -1.88 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
MVHSLHRR |
| 3800 |
696.3416 | 2086.0030 | 2086.0041 | -0.53 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
LQEYMTPIQERAESTFK + Oxidation (M) |
| 3280 |
852.9236 | 1703.8326 | 1703.8301 | 1.51 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
MANSVHPVEIRYSGK + Deamidated (NQ); Oxidation (M) |
| 3953 |
734.7386 | 2201.1940 | 2201.2209 | -12.2 | 1 | 2 | 2 | 1Score > 18 indicates identity |
LATVTRVPVNPFDVSAIVFR + Deamidated (NQ) |
| 1987 |
1019.4833 | 1018.4760 | 1018.4679 | 7.95 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
DETRNQQK + Deamidated (NQ) |
| 1835 |
979.4491 | 978.4418 | 978.4440 | -2.26 | 0 | 2 | 2.8 | 1Score > 19 indicates identity |
ADGSMNLQK + Oxidation (M) |
| 3041 |
765.9099 | 1529.8052 | 1529.8300 | -16.2 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
NLLDNTTLQIEKK + Deamidated (NQ) |
| 4707 |
908.7443 | 6354.1592 | 6354.0341 | 19.7 | 1 | 2 | 0.61 | 1Score > 13 indicates identity |
NNFDELATLLSNYENLINDTHMIFIPGPNDPWSSMVGLGTTTLWPQKEIPSSFVQK + 3 Deamidated (NQ); 2 Oxidation (M) |
| 1722 |
940.4482 | 939.4409 | 939.4522 | -12.0 | 0 | 2 | 2.9 | 1Score > 19 indicates identity |
NGGTDIHAR |
| 1368 |
799.4156 | 798.4083 | 798.4123 | -5.01 | 0 | 2 | 1.9 | 1Score > 17 indicates identity |
ISTTYSK |
| 1461 |
421.7409 | 841.4672 | 841.4592 | 9.51 | 1 | 2 | 1.8 | 1Score > 17 indicates identity |
VVKHGMR + Oxidation (M) |
| 3056 |
769.8671 | 1537.7196 | 1537.7381 | -12.0 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
RMSQFPMQPGLSK + 2 Oxidation (M) |
| 1501 |
859.4873 | 858.4800 | 858.4810 | -1.18 | 1 | 2 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
NNELLKK + Deamidated (NQ) |
| 2177 |
533.7624 | 1065.5102 | 1065.5090 | 1.13 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
LGNTRNNFK + 3 Deamidated (NQ) |
| 1915 |
999.4786 | 998.4713 | 998.4821 | -10.8 | 0 | 2 | 2.3 | 1Score > 18 indicates identity |
NGAFIHDPK + Deamidated (NQ) |
| 3466 |
931.4774 | 1860.9402 | 1860.9217 | 9.96 | 0 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
NISGTIDAPINGGIAEYR + Deamidated (NQ) |
| 1010 |
584.3054 | 583.2981 | 583.3078 | -16.6 | 1 | 2 | 0.63 | 1Score > 13 indicates identity |
KNHGK + Deamidated (NQ) |
| 1276 |
743.3547 | 742.3474 | 742.3358 | 15.7 | 0 | 2 | 0.91 | 1Score > 14 indicates identity |
NNSHGSK |
| 1211 |
702.3253 | 701.3180 | 701.3231 | -7.29 | 0 | 2 | 0.7 | 1Score > 13 indicates identity |
INNNPK + 3 Deamidated (NQ) |
| 3031 |
762.3552 | 1522.6958 | 1522.6973 | -0.97 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
ENKICDSNFPGIK + 2 Deamidated (NQ) |
| 2801 |
446.2263 | 1335.6571 | 1335.6452 | 8.85 | 0 | 2 | 0.82 | 1Score > 22 indicates identity Score > 14 indicates homology |
AVQESMSTLNTR |
| 3453 |
618.2831 | 1851.8275 | 1851.8461 | -10.1 | 0 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
AIGNWAPYVAGANMDASK + Deamidated (NQ); Oxidation (M) |
| 4400 |
989.4772 | 2965.4098 | 2965.4127 | -1.00 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
VMSSNYLSYQPAIGRNSTFVGLSDSQK + Deamidated (NQ); Oxidation (M) |
| 1122 |
328.1930 | 654.3714 | 654.3701 | 2.10 | 0 | 2 | 0.65 | 1Score > 13 indicates identity |
SVPAPGK |
| 2976 |
497.5761 | 1489.7065 | 1489.7195 | -8.73 | 0 | 2 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
HNGTAGSSLLASMTK + Oxidation (M) |
| 3750 |
688.9825 | 2063.9257 | 2063.9139 | 5.71 | 1 | 2 | 3 | 1Score > 19 indicates identity |
LNAKMNEIKPNDNEEMR + 3 Deamidated (NQ); Oxidation (M) |
| 1131 |
665.3749 | 664.3676 | 664.3657 | 2.95 | 0 | 2 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
QHGVPK |
| 2046 |
517.7688 | 1033.5230 | 1033.5161 | 6.72 | 1 | 2 | 0.81 | 1Score > 21 indicates identity Score > 13 indicates homology |
KPCSRCVK |
| 3578 |
983.4504 | 1964.8862 | 1964.8745 | 5.97 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
MSNNTETDKQVNIGPSGR + 2 Deamidated (NQ); Oxidation (M) |
| 1888 |
496.7457 | 991.4768 | 991.4644 | 12.5 | 0 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
NNLMIADGK + Deamidated (NQ); Oxidation (M) |
| 2626 |
1183.5630 | 1182.5557 | 1182.5591 | -2.81 | 0 | 2 | 0.74 | 1Score > 20 indicates identity Score > 13 indicates homology |
NEFVEMSIAK + Oxidation (M) |
| 1902 |
498.2812 | 994.5478 | 994.5521 | -4.28 | 1 | 2 | 2.5 | 1Score > 18 indicates identity |
MLIKQSFK + Deamidated (NQ) |
| 3538 |
968.5125 | 1935.0104 | 1935.0425 | -16.6 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
QNIHPVITESAKTELVR + Deamidated (NQ) |
| 2226 |
540.7961 | 1079.5776 | 1079.5910 | -12.3 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
GRALIMTYR |
| 2796 |
666.8491 | 1331.6836 | 1331.6867 | -2.30 | 1 | 2 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
QAVMLALDKGNR + Deamidated (NQ); Oxidation (M) |
| 3100 |
787.9014 | 1573.7882 | 1573.8100 | -13.8 | 0 | 2 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
SDPIGIAYLNQNLR + Deamidated (NQ) |
| 1166 |
341.2009 | 680.3872 | 680.3857 | 2.26 | 0 | 2 | 0.67 | 1Score > 13 indicates identity |
AAPTPPK |
| 1013 |
584.3411 | 583.3338 | 583.3442 | -17.7 | 0 | 2 | 0.67 | 1Score > 13 indicates identity |
KPPSR |
| 4406 |
990.5259 | 2968.5559 | 2968.5983 | -14.3 | 0 | 2 | 2 | 1Score > 17 indicates identity |
NQVSLTIFALFVALIGQAFMIGASEALK + Deamidated (NQ); Oxidation (M) |
| 1982 |
1018.4835 | 1017.4762 | 1017.4913 | -14.8 | 0 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
MSTPEQAVR |
| 2931 |
726.3748 | 1450.7350 | 1450.7164 | 12.8 | 1 | 2 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
TPRNSLDSVGSYR |
| 2878 |
711.3958 | 1420.7770 | 1420.7786 | -1.11 | 0 | 2 | 3 | 1Score > 19 indicates identity |
QQLLSNHAILQR + Deamidated (NQ) |
| 4466 |
1047.8423 | 3140.5051 | 3140.5396 | -11.0 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
HFPGELFSVAPYFQRNFPNLFVLNER + 3 Deamidated (NQ) |
| 2372 |
1122.5090 | 1121.5017 | 1121.5142 | -11.1 | 0 | 2 | 3 | 1Score > 19 indicates identity |
KPEGWQNYT |
| 4073 |
776.3727 | 2326.0963 | 2326.0812 | 6.49 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
SIVSGYKENSELENNDSVNVK + 2 Deamidated (NQ) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/