MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 1 |
| MS data file | : | PRT1245_Other_P1_B9.mgf |
| Database | : | K-marxianus 20241107 (5,052 sequences; 2,515,027 residues) |
| Timestamp | : | 24 Jun 2025 at 21:28:59 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,728 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 20 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 1683 |
928.4138 | 927.4065 | 927.4120 | -5.92 | 0 | 5 | 0.69 | 1Score > 16 indicates identity |
YDMGTVSR |
| 2003 |
512.2512 | 1022.4878 | 1022.5066 | -18.4 | 0 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
MNSNITSIK + Oxidation (M) |
| 1775 |
478.7373 | 955.4600 | 955.4658 | -5.98 | 1 | 5 | 1.3 | 1Score > 19 indicates identity |
NCEKLHR |
| 1608 |
453.2423 | 904.4700 | 904.4688 | 1.37 | 0 | 5 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
EGGIMGVVK + Oxidation (M) |
| 1577 |
446.7365 | 891.4584 | 891.4596 | -1.32 | 1 | 5 | 0.72 | 1Score > 22 indicates identity Score > 16 indicates homology |
LGMRGQSK + Oxidation (M) |
| 2315 |
553.2643 | 1104.5140 | 1104.5233 | -8.39 | 1 | 5 | 0.95 | 1Score > 20 indicates identity Score > 17 indicates homology |
NMELEARDK |
| 2511 |
577.7504 | 1153.4862 | 1153.4921 | -5.07 | 0 | 5 | 0.93 | 1Score > 17 indicates identity |
TQMENGITSR + 2 Deamidated (NQ); Oxidation (M) |
| 2677 |
607.3464 | 1212.6782 | 1212.6826 | -3.59 | 1 | 5 | 1.6 | 1Score > 19 indicates identity |
KNGNLDLGIIR + Deamidated (NQ) |
| 3206 |
822.8383 | 1643.6620 | 1643.6872 | -15.3 | 0 | 5 | 0.37 | 1Score > 13 indicates identity |
EIDSEVDGMTEYQK + Deamidated (NQ) |
| 3270 |
847.3845 | 1692.7544 | 1692.7665 | -7.11 | 1 | 5 | 1.4 | 1Score > 19 indicates identity |
MSEYDKYTTPLSSR + Oxidation (M) |
| 4066 |
1161.5581 | 2321.1016 | 2321.0693 | 13.9 | 0 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
LSEMVVANGDDSTKPVAEDSNK + Oxidation (M) |
| 2115 |
525.2886 | 1048.5626 | 1048.5665 | -3.69 | 1 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
ANGLQKYVR + Deamidated (NQ) |
| 1498 |
429.2083 | 856.4020 | 856.4000 | 2.34 | 0 | 5 | 1.2 | 1Score > 18 indicates identity |
TSMLFNK + Deamidated (NQ); Oxidation (M) |
| 1406 |
821.4272 | 820.4199 | 820.4191 | 0.97 | 1 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
RNLFDR + Deamidated (NQ) |
| 1297 |
379.6939 | 757.3732 | 757.3719 | 1.84 | 0 | 5 | 1 | 1Score > 17 indicates identity |
INPGDSR |
| 1517 |
434.1959 | 866.3772 | 866.3817 | -5.14 | 0 | 5 | 1.2 | 1Score > 18 indicates identity |
HNNHMAK + Oxidation (M) |
| 3632 |
998.4750 | 1994.9354 | 1994.9181 | 8.71 | 1 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
RIQEQNNSVEIYSDGNK + 2 Deamidated (NQ) |
| 4645 |
1145.3274 | 4577.2805 | 4577.2238 | 12.4 | 0 | 5 | 1 | 1Score > 17 indicates identity |
TLEETLNGSVLEPPAQVQTSSSSEEINWYSSFHGIGSKPFPK |
| 933 |
499.2883 | 498.2810 | 498.2802 | 1.63 | 0 | 5 | 0.35 | 1Score > 13 indicates identity |
GVVPQ |
| 2117 |
525.2931 | 1048.5716 | 1048.5852 | -12.9 | 1 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
MVLRLDFR |
| 1809 |
967.4905 | 966.4832 | 966.4658 | 18.0 | 0 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
NQIQSFTK + 2 Deamidated (NQ) |
| 2011 |
1024.5107 | 1023.5034 | 1023.5025 | 0.89 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
IKNDYWGK + Deamidated (NQ) |
| 1785 |
960.5276 | 959.5203 | 959.5036 | 17.5 | 1 | 4 | 0.42 | 1Score > 22 indicates identity Score > 13 indicates homology |
QSINNVKR + 2 Deamidated (NQ) |
| 2840 |
692.3411 | 1382.6676 | 1382.6578 | 7.11 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
NANKIQNYNFR + 2 Deamidated (NQ) |
| 1143 |
669.3584 | 668.3511 | 668.3606 | -14.1 | 0 | 4 | 0.71 | 1Score > 15 indicates identity |
RPDGPK |
| 2469 |
573.2867 | 1144.5588 | 1144.5724 | -11.8 | 1 | 4 | 0.46 | 1Score > 21 indicates identity Score > 14 indicates homology |
NQEQILNKR + 3 Deamidated (NQ) |
| 2005 |
512.2849 | 1022.5552 | 1022.5437 | 11.3 | 0 | 4 | 1.7 | 1Score > 19 indicates identity |
QLVEFYPK |
| 2957 |
739.8544 | 1477.6942 | 1477.7157 | -14.5 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
GTTVGIMPSPMEVK + 2 Oxidation (M) |
| 3515 |
956.4812 | 1910.9478 | 1910.9785 | -16.0 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
GGLGNMHFLTNLIRNPR + 2 Deamidated (NQ) |
| 1612 |
454.2154 | 906.4162 | 906.4303 | -15.5 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
IMLQDMR + Deamidated (NQ) |
| 1878 |
495.7411 | 989.4676 | 989.4665 | 1.14 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
LSEEDIER |
| 2868 |
703.8558 | 1405.6970 | 1405.7201 | -16.4 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
IGNDNIKTFNLR + 2 Deamidated (NQ) |
| 1428 |
416.2151 | 830.4156 | 830.4134 | 2.74 | 1 | 4 | 0.58 | 1Score > 21 indicates identity Score > 14 indicates homology |
KDESPQK |
| 1502 |
860.4210 | 859.4137 | 859.4147 | -1.19 | 1 | 4 | 0.58 | 1Score > 20 indicates identity Score > 14 indicates homology |
GNNLQRR + 3 Deamidated (NQ) |
| 2114 |
525.2886 | 1048.5626 | 1048.5665 | -3.69 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
ANGLQKYVR + Deamidated (NQ) |
| 1281 |
748.3193 | 747.3120 | 747.3221 | -13.5 | 0 | 4 | 0.48 | 1Score > 13 indicates identity |
ESMTHK + Oxidation (M) |
| 1830 |
488.7659 | 975.5172 | 975.4985 | 19.2 | 0 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
LGASLANSSR + Deamidated (NQ) |
| 1747 |
474.2411 | 946.4676 | 946.4607 | 7.32 | 0 | 4 | 0.99 | 1Score > 21 indicates identity Score > 17 indicates homology |
IEVSEAGDK |
| 1302 |
764.4310 | 763.4237 | 763.4228 | 1.18 | 1 | 4 | 0.49 | 1Score > 20 indicates identity Score > 13 indicates homology |
NLKDFK |
| 990 |
558.2901 | 557.2828 | 557.2809 | 3.43 | 0 | 4 | 0.56 | 1Score > 14 indicates identity |
QGEPK |
| 3287 |
855.3630 | 1708.7114 | 1708.7289 | -10.2 | 1 | 4 | 0.77 | 1Score > 15 indicates identity |
GGNSNNGSSSTGKHFQK + 3 Deamidated (NQ) |
| 1363 |
398.2228 | 794.4310 | 794.4286 | 3.06 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
RYISEK |
| 1836 |
490.2289 | 978.4432 | 978.4440 | -0.77 | 1 | 4 | 1.8 | 1Score > 19 indicates identity |
ANAGNKMQK + 2 Deamidated (NQ); Oxidation (M) |
| 1556 |
441.7389 | 881.4632 | 881.4607 | 2.92 | 0 | 4 | 1.5 | 1Score > 18 indicates identity |
QGTHLTPK + Deamidated (NQ) |
| 2504 |
1151.5509 | 1150.5436 | 1150.5353 | 7.20 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
VTENVSASESK + Deamidated (NQ) |
| 1980 |
1016.5290 | 1015.5217 | 1015.5298 | -7.94 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
AEKNNVVNK + Deamidated (NQ) |
| 2206 |
538.2865 | 1074.5584 | 1074.5709 | -11.6 | 1 | 4 | 0.56 | 1Score > 21 indicates identity Score > 14 indicates homology |
IEGLSKWNK + Deamidated (NQ) |
| 2733 |
635.8063 | 1269.5980 | 1269.6023 | -3.37 | 1 | 4 | 1.9 | 1Score > 19 indicates identity |
VSTDCYQRLK + Deamidated (NQ) |
| 2978 |
745.8618 | 1489.7090 | 1489.6831 | 17.4 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
HATQQSNTMKSEK + Deamidated (NQ) |
| 1017 |
586.3901 | 585.3828 | 585.3737 | 15.5 | 0 | 4 | 0.66 | 1Score > 15 indicates identity |
IIVEL |
| 4558 |
1184.5691 | 3550.6855 | 3550.6798 | 1.60 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
TNALIPINTASNSNSNSASSSALEINGVSFIDPNK + 4 Deamidated (NQ) |
| 3968 |
1109.0143 | 2216.0140 | 2215.9981 | 7.18 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
GINGLQQQQQPSQQYPDQR + 4 Deamidated (NQ) |
| 2735 |
635.8490 | 1269.6834 | 1269.6928 | -7.40 | 1 | 4 | 2.1 | 1Score > 20 indicates identity |
IPVATDEEIRK |
| 4557 |
1184.5688 | 3550.6846 | 3550.6798 | 1.35 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
TNALIPINTASNSNSNSASSSALEINGVSFIDPNK + 4 Deamidated (NQ) |
| 1548 |
880.4176 | 879.4103 | 879.3947 | 17.8 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
ANGSTHHR + Deamidated (NQ) |
| 3730 |
1029.4885 | 2056.9624 | 2056.9297 | 15.9 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
DKIPDVNANGNGNVNGASNGK + 3 Deamidated (NQ) |
| 1032 |
602.3430 | 601.3357 | 601.3435 | -12.9 | 0 | 4 | 0.75 | 1Score > 21 indicates identity Score > 15 indicates homology |
LINDK |
| 2802 |
669.3263 | 1336.6380 | 1336.6445 | -4.84 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
MARSLSWDDLK + Oxidation (M) |
| 4043 |
768.3829 | 2302.1269 | 2302.0924 | 15.0 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
QPNSTAGELRTESNAINQVIR + 5 Deamidated (NQ) |
| 4641 |
752.1891 | 4507.0909 | 4507.0669 | 5.33 | 0 | 4 | 1.5 | 1Score > 18 indicates identity |
VSEIQTQLPSFDESTVEAASQVGQMVSDASNQIGYLSSIGMAK + 5 Deamidated (NQ) |
| 2022 |
514.2578 | 1026.5010 | 1026.4883 | 12.4 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
WHNQSGIGK + Deamidated (NQ) |
| 2872 |
705.8613 | 1409.7080 | 1409.7224 | -10.2 | 0 | 4 | 0.98 | 1Score > 20 indicates identity Score > 16 indicates homology |
SLFNVSGMIADLK + Oxidation (M) |
| 1301 |
764.4294 | 763.4221 | 763.4228 | -0.91 | 1 | 4 | 0.47 | 1Score > 21 indicates identity Score > 13 indicates homology |
NLKDFK |
| 1472 |
846.4427 | 845.4354 | 845.4429 | -8.85 | 1 | 4 | 0.67 | 1Score > 23 indicates identity Score > 14 indicates homology |
KDPIMAR + Oxidation (M) |
| 2165 |
532.2690 | 1062.5234 | 1062.5346 | -10.5 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
AVNVAPSDYK |
| 2271 |
546.7725 | 1091.5304 | 1091.5207 | 8.94 | 1 | 4 | 0.82 | 1Score > 21 indicates identity Score > 15 indicates homology |
RSSSENIDGK |
| 2863 |
702.3655 | 1402.7164 | 1402.6940 | 16.0 | 0 | 4 | 0.51 | 1Score > 21 indicates identity Score > 13 indicates homology |
LQSVNQQLDSLR + 3 Deamidated (NQ) |
| 1981 |
1017.5507 | 1016.5434 | 1016.5291 | 14.1 | 0 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
ANDVIATWK |
| 938 |
502.3053 | 501.2980 | 501.2911 | 13.9 | 0 | 4 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
GANIK |
| 2880 |
713.3417 | 1424.6688 | 1424.6969 | -19.7 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
VAQVLQYSMNVR + 2 Deamidated (NQ); Oxidation (M) |
| 2320 |
553.2930 | 1104.5714 | 1104.5710 | 0.43 | 1 | 4 | 0.55 | 1Score > 21 indicates identity Score > 13 indicates homology |
RQSMVEVTR |
| 2643 |
1188.6240 | 1187.6167 | 1187.6146 | 1.79 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
SGSNNLLDVLR + Deamidated (NQ) |
| 1378 |
802.4003 | 801.3930 | 801.3868 | 7.75 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
LNPNESK + Deamidated (NQ) |
| 1123 |
657.3577 | 656.3504 | 656.3493 | 1.66 | 0 | 4 | 1.1 | 1Score > 17 indicates identity |
LQPGDK |
| 3770 |
1038.0488 | 2074.0830 | 2074.0596 | 11.3 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
YHSILTRTDTFDTVIHR |
| 3110 |
792.8667 | 1583.7188 | 1583.7151 | 2.38 | 0 | 3 | 0.61 | 1Score > 20 indicates identity Score > 14 indicates homology |
HIGGVADHNMYPTR + Deamidated (NQ); Oxidation (M) |
| 3576 |
655.6341 | 1963.8805 | 1963.8905 | -5.12 | 1 | 3 | 2 | 1Score > 19 indicates identity |
MSNNTETDKQVNIGPSGR + Deamidated (NQ); Oxidation (M) |
| 1076 |
628.3434 | 627.3361 | 627.3452 | -14.5 | 1 | 3 | 0.97 | 1Score > 16 indicates identity |
RAEPR |
| 1422 |
414.2185 | 826.4224 | 826.4371 | -17.7 | 0 | 3 | 2.1 | 1Score > 19 indicates identity |
GQPIMGPK |
| 2875 |
709.3248 | 1416.6350 | 1416.6534 | -13.0 | 0 | 3 | 1.9 | 1Score > 19 indicates identity |
ADGWISQAHYNR |
| 3911 |
721.7194 | 2162.1364 | 2162.1041 | 14.9 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
IMQYIAAASDTHEASIGKIK + Oxidation (M) |
| 988 |
557.2960 | 556.2887 | 556.2969 | -14.7 | 0 | 3 | 0.64 | 1Score > 14 indicates identity |
VGPER |
| 1408 |
411.2361 | 820.4576 | 820.4443 | 16.3 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
DVGKQFK |
| 2614 |
590.2883 | 1178.5620 | 1178.5642 | -1.79 | 0 | 3 | 0.77 | 1Score > 21 indicates identity Score > 15 indicates homology |
QPSMGPTFGIK + Deamidated (NQ); Oxidation (M) |
| 2693 |
611.8120 | 1221.6094 | 1221.6201 | -8.68 | 1 | 3 | 0.82 | 1Score > 22 indicates identity Score > 15 indicates homology |
SKSISAASTNEK |
| 3309 |
863.4120 | 1724.8094 | 1724.8403 | -17.9 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
NTMNLLANGNHPGIIK + 3 Deamidated (NQ); Oxidation (M) |
| 1259 |
367.1909 | 732.3672 | 732.3806 | -18.3 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
ATLWDK |
| 2926 |
725.3505 | 1448.6864 | 1448.7115 | -17.3 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
NLNIVQMMQVAR + Deamidated (NQ); 2 Oxidation (M) |
| 2603 |
588.7821 | 1175.5496 | 1175.5611 | -9.74 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
WAPVNSPNYK + Deamidated (NQ) |
| 2465 |
572.7885 | 1143.5624 | 1143.5825 | -17.6 | 0 | 3 | 0.83 | 1Score > 20 indicates identity Score > 15 indicates homology |
NGAGFFHVAPK |
| 3577 |
983.4493 | 1964.8840 | 1964.8745 | 4.85 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
MSNNTETDKQVNIGPSGR + 2 Deamidated (NQ); Oxidation (M) |
| 3111 |
792.8883 | 1583.7620 | 1583.7427 | 12.2 | 1 | 3 | 0.99 | 1Score > 21 indicates identity Score > 16 indicates homology |
QNTPLGNDIPDDRK + 2 Deamidated (NQ) |
| 3736 |
687.3537 | 2059.0393 | 2059.0731 | -16.4 | 1 | 3 | 0.58 | 1Score > 21 indicates identity Score > 13 indicates homology |
MSSVAAAQNKINDLLEAIR + Oxidation (M) |
| 3738 |
1030.5306 | 2059.0466 | 2059.0731 | -12.9 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
MSSVAAAQNKINDLLEAIR + Oxidation (M) |
| 1692 |
932.4529 | 931.4456 | 931.4610 | -16.6 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
DLSEEALR |
| 1533 |
877.4250 | 876.4177 | 876.4124 | 6.13 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
VTLCDNR |
| 1148 |
671.4230 | 670.4157 | 670.4126 | 4.66 | 0 | 3 | 1.2 | 1Score > 16 indicates identity |
VLNAVR |
| 2686 |
610.3062 | 1218.5978 | 1218.6067 | -7.23 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
MTPLKNNWAK + Deamidated (NQ); Oxidation (M) |
| 3081 |
781.8981 | 1561.7816 | 1561.7624 | 12.4 | 0 | 3 | 0.61 | 1Score > 22 indicates identity Score > 14 indicates homology |
AELLSFTNNIPEGR + 2 Deamidated (NQ) |
| 1265 |
736.3653 | 735.3580 | 735.3551 | 3.93 | 0 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
GEFNLR + Deamidated (NQ) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/