MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 4 |
| MS data file | : | PRT1245_Other_P1_B12.mgf |
| Database | : | S-cerevisiae-S288C 20191206 (6,886 sequences; 3,133,934 residues) |
| Timestamp | : | 24 Jun 2025 at 21:22:18 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,772 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 3145 |
845.9479 | 1689.8812 | 1689.8542 | 16.0 | 1 | 1 | 0.84 | 1Score > 21 indicates identity Score > 13 indicates homology |
KIICPSVESISNGMR |
| 3492 |
970.9824 | 1939.9502 | 1939.9231 | 14.0 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
GISNMMLSLTIENSEGTK + Oxidation (M) |
| 1444 |
456.2334 | 910.4522 | 910.4508 | 1.55 | 0 | 1 | 3.9 | 1Score > 20 indicates identity |
DLEVNGHK |
| 2865 |
756.8346 | 1511.6546 | 1511.6762 | -14.2 | 0 | 1 | 2.8 | 1Score > 18 indicates identity |
TAAAMWGCHIHNK + Oxidation (M) |
| 2963 |
523.9294 | 1568.7664 | 1568.7617 | 3.00 | 0 | 1 | 0.88 | 1Score > 21 indicates identity Score > 13 indicates homology |
MNNTSITGPQVLHR + 2 Deamidated (NQ) |
| 3931 |
1081.5217 | 2161.0288 | 2161.0547 | -12.0 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
MGPTFGAMALSGVHAAEQILK + Deamidated (NQ); 2 Oxidation (M) |
| 4107 |
1152.5762 | 2303.1378 | 2303.1501 | -5.31 | 1 | 1 | 0.96 | 1Score > 22 indicates identity Score > 13 indicates homology |
LQQLSESIKITEMQLNHMK + Deamidated (NQ); 2 Oxidation (M) |
| 1506 |
934.4514 | 933.4441 | 933.4376 | 6.97 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
NNSRSNSR |
| 2515 |
601.7903 | 1201.5660 | 1201.5761 | -8.36 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
ANTPSSMHKTK + Deamidated (NQ) |
| 1027 |
342.1962 | 682.3778 | 682.3762 | 2.41 | 1 | 1 | 2.3 | 1Score > 17 indicates identity |
GPKEPR |
| 1578 |
953.4333 | 952.4260 | 952.4362 | -10.7 | 1 | 1 | 3.3 | 1Score > 19 indicates identity |
DAYRGQSR + Deamidated (NQ) |
| 2047 |
542.7632 | 1083.5118 | 1083.5019 | 9.22 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
RLQGNGMYK + 2 Deamidated (NQ); Oxidation (M) |
| 1402 |
897.4385 | 896.4312 | 896.4426 | -12.7 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
MSFVQIR + Deamidated (NQ); Oxidation (M) |
| 3419 |
469.9758 | 1875.8741 | 1875.9115 | -20.0 | 1 | 1 | 0.86 | 1Score > 22 indicates identity Score > 13 indicates homology |
REPFFHGTSNTDQLVK + Deamidated (NQ) |
| 3539 |
984.9896 | 1967.9646 | 1967.9297 | 17.8 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
TSGLLAPTDDHNGEQTRR + Deamidated (NQ) |
| 2286 |
571.7576 | 1141.5006 | 1141.5000 | 0.59 | 0 | 1 | 2.8 | 1Score > 18 indicates identity |
GEPSEPQQDR |
| 3441 |
947.5040 | 1892.9934 | 1892.9672 | 13.8 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
WIFESVWAGLTELTNK |
| 3940 |
722.3496 | 2164.0270 | 2164.0396 | -5.84 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
SNNKNEDTFQQVSLNDIAK |
| 4300 |
843.0583 | 2526.1531 | 2526.1413 | 4.64 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
FMYDTFDDHYQATIGIDFLSK |
| 1368 |
882.4701 | 881.4628 | 881.4607 | 2.45 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
ANGGEPLPK |
| 3887 |
1068.5294 | 2135.0442 | 2135.0429 | 0.62 | 0 | 1 | 0.88 | 1Score > 23 indicates identity Score > 13 indicates homology |
LGIEIDNGNHMLLSGNHSAK + Oxidation (M) |
| 4408 |
932.7827 | 2795.3263 | 2795.3470 | -7.40 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
NVIPLASKMEVGSNEDVSSMGNFINK + Oxidation (M) |
| 2997 |
794.9075 | 1587.8004 | 1587.8256 | -15.9 | 1 | 1 | 1 | 1Score > 24 indicates identity Score > 14 indicates homology |
AAQNPLADIQVYKR + 2 Deamidated (NQ) |
| 4741 |
930.1601 | 5574.9169 | 5574.8558 | 11.0 | 1 | 1 | 0.79 | 1Score > 13 indicates identity |
MLQFNTENDTVAPVFPMEQDINAAPDAVPLVQTTTLQVFVKLAEPIVFLK + Deamidated (NQ); 2 Oxidation (M) |
| 1099 |
372.6861 | 743.3576 | 743.3490 | 11.6 | 0 | 1 | 3.3 | 1Score > 19 indicates identity |
EGTYFK |
| 4146 |
1170.0486 | 2338.0826 | 2338.0522 | 13.0 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
LDFESQDVSNLDSNLGMDPLK + 2 Deamidated (NQ) |
| 1591 |
478.7625 | 955.5104 | 955.5127 | -2.35 | 0 | 1 | 2.9 | 1Score > 18 indicates identity |
NVPIWAQK + Deamidated (NQ) |
| 1262 |
836.4387 | 835.4314 | 835.4188 | 15.1 | 0 | 1 | 0.93 | 1Score > 23 indicates identity Score > 13 indicates homology |
ALNFTNR + Deamidated (NQ) |
| 2151 |
553.2915 | 1104.5684 | 1104.5788 | -9.38 | 1 | 1 | 0.82 | 1Score > 23 indicates identity Score > 13 indicates homology |
QRSFNANLR |
| 2699 |
695.3430 | 1388.6714 | 1388.6531 | 13.2 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
NPSRSIADSAQNK + 2 Deamidated (NQ) |
| 4410 |
933.1144 | 2796.3214 | 2796.3011 | 7.25 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
QLKFLNMENETTVDDLQDQLQEK + 2 Deamidated (NQ); Oxidation (M) |
| 2946 |
781.8945 | 1561.7744 | 1561.7592 | 9.74 | 0 | 1 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
IICPSVESISNGMR |
| 2348 |
578.2725 | 1154.5304 | 1154.5105 | 17.3 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
HNLADQDWR + Deamidated (NQ) |
| 2655 |
669.3469 | 1336.6792 | 1336.6834 | -3.10 | 1 | 1 | 0.99 | 1Score > 23 indicates identity Score > 13 indicates homology |
KESGLTSNSLSSK |
| 1511 |
468.7132 | 935.4118 | 935.4270 | -16.2 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
TSEMLDPK + Oxidation (M) |
| 1563 |
475.2597 | 948.5048 | 948.4950 | 10.4 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
AMKNIEVK + Deamidated (NQ); Oxidation (M) |
| 2208 |
560.7792 | 1119.5438 | 1119.5349 | 8.00 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
NILFFNHNT + Deamidated (NQ) |
| 2313 |
1148.5342 | 1147.5269 | 1147.5217 | 4.53 | 1 | 1 | 0.83 | 1Score > 21 indicates identity Score > 13 indicates homology |
SKNSNVNNNR + 2 Deamidated (NQ) |
| 3888 |
1068.5321 | 2135.0496 | 2135.0146 | 16.4 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
IQVHYMNYGESIKFFSR + Deamidated (NQ); Oxidation (M) |
| 2720 |
707.8364 | 1413.6582 | 1413.6785 | -14.3 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
DWMKMVANLYK + Oxidation (M) |
| 2584 |
636.3036 | 1270.5926 | 1270.5830 | 7.62 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
DADFRYQDLK + Deamidated (NQ) |
| 4361 |
898.0777 | 2691.2113 | 2691.2295 | -6.78 | 1 | 1 | 4.1 | 1Score > 19 indicates identity |
CYKQLPLGEVAQQQYDSMITSTK + 4 Deamidated (NQ) |
| 3422 |
939.4550 | 1876.8954 | 1876.8634 | 17.1 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
CQYFVTLLCMERNK + Oxidation (M) |
| 985 |
657.3573 | 656.3500 | 656.3493 | 1.07 | 0 | 1 | 2 | 1Score > 16 indicates identity |
LGENPK |
| 1699 |
496.2668 | 990.5190 | 990.5056 | 13.6 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
AMGINDLLK + Deamidated (NQ); Oxidation (M) |
| 2695 |
462.5398 | 1384.5976 | 1384.5929 | 3.41 | 1 | 1 | 3 | 1Score > 18 indicates identity |
YNNENGSMPSKK + Deamidated (NQ); Oxidation (M) |
| 2669 |
451.8979 | 1352.6719 | 1352.6659 | 4.39 | 1 | 1 | 0.86 | 1Score > 22 indicates identity Score > 13 indicates homology |
MASRFTFPPQR + Oxidation (M) |
| 4283 |
834.4146 | 2500.2220 | 2500.2341 | -4.87 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
APQAAGVIHNDLMNTFILAQVMK + 3 Deamidated (NQ); Oxidation (M) |
| 3077 |
821.8687 | 1641.7228 | 1641.6907 | 19.6 | 0 | 1 | 4.1 | 1Score > 19 indicates identity |
FYNTHTGSNINDTR + 3 Deamidated (NQ) |
| 3341 |
916.9874 | 1831.9602 | 1831.9325 | 15.2 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
VTKLDVPMGIMHFNSK + Oxidation (M) |
| 3901 |
715.3929 | 2143.1569 | 2143.1623 | -2.55 | 1 | 1 | 2.9 | 1Score > 18 indicates identity |
SSDITAILPTEQSQKLVLAK + 2 Deamidated (NQ) |
| 1321 |
860.4171 | 859.4098 | 859.4188 | -10.4 | 0 | 1 | 3.1 | 1Score > 18 indicates identity |
WADEALR |
| 3418 |
938.4500 | 1874.8854 | 1874.8799 | 2.97 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
YDNPTGGVYQVYNTRK + Deamidated (NQ) |
| 2452 |
589.7953 | 1177.5760 | 1177.5649 | 9.51 | 1 | 1 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
QLSEMQKDAK + Deamidated (NQ) |
| 4571 |
1039.4954 | 3115.4644 | 3115.5230 | -18.8 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
LENDLNEELVGQLSKTMDNLENLTIPR + 2 Deamidated (NQ); Oxidation (M) |
| 2221 |
1124.5410 | 1123.5337 | 1123.5397 | -5.29 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
SLQNYLQEK + 2 Deamidated (NQ) |
| 1716 |
498.7416 | 995.4686 | 995.4560 | 12.7 | 0 | 1 | 0.99 | 1Score > 21 indicates identity Score > 13 indicates homology |
QGLEGNSYK + Deamidated (NQ) |
| 2947 |
781.8972 | 1561.7798 | 1561.8100 | -19.3 | 1 | 1 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
DINDININFAAKSK |
| 1150 |
778.3740 | 777.3667 | 777.3691 | -3.01 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
KLDNCK + Deamidated (NQ) |
| 3063 |
816.9005 | 1631.7864 | 1631.7712 | 9.35 | 1 | 1 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
LGQQNNLPKLDMNK + 4 Deamidated (NQ); Oxidation (M) |
| 3439 |
947.4977 | 1892.9808 | 1892.9672 | 7.19 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
WIFESVWAGLTELTNK |
| 3478 |
644.6515 | 1930.9327 | 1930.9272 | 2.83 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
DLDGGSKVISQWAPENSK + Deamidated (NQ) |
| 2866 |
756.8788 | 1511.7430 | 1511.7290 | 9.32 | 1 | 1 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
AMEELNYTKVNGK + Oxidation (M) |
| 3001 |
530.6088 | 1588.8046 | 1588.8130 | -5.33 | 1 | 1 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
LGAVTGLDLAQNCKK + 2 Deamidated (NQ) |
| 4103 |
768.3836 | 2302.1290 | 2302.1297 | -0.32 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
LIHMERDLSSEVVGQMDAIK + 2 Oxidation (M) |
| 3406 |
933.4354 | 1864.8562 | 1864.8890 | -17.5 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
WVRNLGNMNNVNLYR + 3 Deamidated (NQ) |
| 1095 |
743.4061 | 742.3988 | 742.3974 | 1.98 | 0 | 1 | 2.8 | 1Score > 18 indicates identity |
QGGSAPVK |
| 1122 |
380.2318 | 758.4490 | 758.4398 | 12.1 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
AIRNSAK |
| 1495 |
465.7309 | 929.4472 | 929.4566 | -10.1 | 0 | 1 | 3.7 | 1Score > 19 indicates identity |
IDGNEINR |
| 2186 |
1114.5276 | 1113.5203 | 1113.5376 | -15.5 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
LTAYNGMTVK + Deamidated (NQ); Oxidation (M) |
| 3948 |
1085.5422 | 2169.0698 | 2169.0841 | -6.56 | 1 | 1 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
SAEYSLKEIQIEELQDFK |
| 1946 |
529.7508 | 1057.4870 | 1057.5040 | -16.0 | 0 | 1 | 3.5 | 1Score > 18 indicates identity |
INDEAVSGPR + Deamidated (NQ) |
| 2948 |
521.6007 | 1561.7803 | 1561.7997 | -12.4 | 0 | 1 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
VLQTMSFLMNHLI + Oxidation (M) |
| 4587 |
792.4221 | 3165.6593 | 3165.6907 | -9.93 | 0 | 1 | 3.6 | 1Score > 19 indicates identity |
VLLIQNLPSGTTEQLLSQILGNEALVEIR + 5 Deamidated (NQ) |
| 1184 |
795.4116 | 794.4043 | 794.4188 | -18.2 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
GLFHGHK |
| 4190 |
794.0735 | 2379.1987 | 2379.1602 | 16.2 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
AMTIYWDDHTKKPLSMALNK + Deamidated (NQ); Oxidation (M) |
| 1166 |
392.2043 | 782.3940 | 782.3963 | -2.86 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
NGFFGLK + Deamidated (NQ) |
| 1416 |
899.4950 | 898.4877 | 898.4984 | -11.9 | 1 | 1 | 3.1 | 1Score > 18 indicates identity |
ERLQPTR |
| 2035 |
1081.5197 | 1080.5124 | 1080.5339 | -19.9 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
TLSLFEQNK + 2 Deamidated (NQ) |
| 2823 |
742.8682 | 1483.7218 | 1483.7453 | -15.8 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
GIANTHSSLICSKP |
| 4435 |
952.8108 | 2855.4106 | 2855.4328 | -7.77 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
EYVSLVGQVLLDGSSLSNEEILQFSK + 2 Deamidated (NQ) |
| 3670 |
1022.4603 | 2042.9060 | 2042.9353 | -14.3 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
AKLQVEQEQSLQNYMSK + 4 Deamidated (NQ); Oxidation (M) |
| 3594 |
1002.9807 | 2003.9468 | 2003.9225 | 12.2 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
EFYSSNKFVAGEAVADNR + Deamidated (NQ) |
| 1173 |
393.1978 | 784.3810 | 784.3967 | -19.9 | 0 | 1 | 4 | 1Score > 19 indicates identity |
QAPGLELG + Deamidated (NQ) |
| 1974 |
1064.5161 | 1063.5088 | 1063.5121 | -3.04 | 0 | 1 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
MGPSYVSAPR |
| 2627 |
657.8066 | 1313.5986 | 1313.6186 | -15.2 | 1 | 1 | 0.94 | 1Score > 20 indicates identity Score > 13 indicates homology |
FRMNFEQGLR + Deamidated (NQ); Oxidation (M) |
| 3388 |
929.4566 | 1856.8986 | 1856.9124 | -7.41 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
NVCLKNSEIIQICHK + 2 Deamidated (NQ) |
| 4690 |
911.9836 | 3643.9053 | 3643.9411 | -9.83 | 1 | 1 | 1.8 | 1Score > 16 indicates identity |
WPWRSTQWFMVILSGCNVILLTVLLPETLR + Oxidation (M) |
| 1130 |
382.6870 | 763.3594 | 763.3534 | 7.89 | 0 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
MATPSNK + Oxidation (M) |
| 1969 |
532.2686 | 1062.5226 | 1062.5346 | -11.2 | 0 | 0 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
LGGYPDVSAGK |
| 3913 |
717.9955 | 2150.9647 | 2150.9603 | 2.02 | 0 | 0 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
NLVLTQSNFNGGINNDNNAK + 5 Deamidated (NQ) |
| 1617 |
966.4651 | 965.4578 | 965.4641 | -6.45 | 0 | 0 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
NVLDFCAK |
| 1356 |
878.4495 | 877.4422 | 877.4294 | 14.7 | 0 | 0 | 1 | 1Score > 24 indicates identity Score > 13 indicates homology |
RPYDAEK |
| 2791 |
487.5854 | 1459.7344 | 1459.7154 | 13.0 | 0 | 0 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
INGLNSNNSIIGNK + 3 Deamidated (NQ) |
| 4019 |
1112.4905 | 2222.9664 | 2222.9936 | -12.2 | 1 | 0 | 3.5 | 1Score > 18 indicates identity |
DQGMNRIGNLLVPNDNYCK + 3 Deamidated (NQ) |
| 4613 |
1090.8507 | 3269.5303 | 3269.5186 | 3.56 | 1 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
NLINIDKVPGWLAGENGSFSGTIMNGDFQR + 4 Deamidated (NQ); Oxidation (M) |
| 4753 |
943.4778 | 5654.8231 | 5654.7796 | 7.70 | 0 | 0 | 1.7 | 1Score > 15 indicates identity |
GWAPQVLVLDHPSLGCFLTHCGWNSTIEGITAGVPLITWPVFAEQFYNEK |
| 1040 |
696.3322 | 695.3249 | 695.3126 | 17.7 | 0 | 0 | 4.2 | 1Score > 19 indicates identity |
AADYQK + Deamidated (NQ) |
| 2078 |
545.2941 | 1088.5736 | 1088.5760 | -2.19 | 1 | 0 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
RVAAMSVAQR + Deamidated (NQ) |
| 3818 |
702.9949 | 2105.9629 | 2105.9914 | -13.6 | 1 | 0 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
FPQYKLTTFANQVMMDR + Deamidated (NQ); Oxidation (M) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/