MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 4
MS data file : PRT1245_Other_P1_B12.mgf
Database : S-cerevisiae-S288C 20191206 (6,886 sequences; 3,133,934 residues)
Timestamp : 24 Jun 2025 at 21:22:18 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,772

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 401–500 (out of 4709)

Page: Previous 1 2 3 4 5 6 7 8 9 10 … 48 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
972 326.1823 650.3500 650.3387 17.4 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 AYELR
1252 828.4022 827.3949 827.3886 7.69 0 2 1.5 +1Score > 17 indicates identity LSDHSNR
2517 603.2969 1204.5792 1204.5944 -12.6 1 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 GPLKGCLNMSK + Deamidated (NQ)
3024 801.9238 1601.8330 1601.8382 -3.19 1 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 STVPIIIRCCIDR
1180 794.3686 793.3613 793.3640 -3.39 0 2 0.97 +1Score > 21 indicates identity
Score > 15 indicates homology		 TTCGDLK
1456 916.4481 915.4408 915.4297 12.1 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 NNTDNLPK + Deamidated (NQ)
2691 691.3234 1380.6322 1380.6451 -9.31 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 QLMMVIMLDNR + 2 Deamidated (NQ); Oxidation (M)
3154 849.3856 1696.7566 1696.7726 -9.40 0 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 SMEQNYLRPEIGSR + 2 Deamidated (NQ); Oxidation (M)
947 315.6645 629.3144 629.3133 1.86 0 2 1.3 +1Score > 16 indicates identity TAQPGR + Deamidated (NQ)
1432 454.7280 907.4414 907.4433 -2.04 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 TSLNIMGR + Deamidated (NQ); Oxidation (M)
2891 510.5843 1528.7311 1528.7481 -11.2 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 GEQGAIDIKGGNVNR + 2 Deamidated (NQ)
3142 845.9384 1689.8622 1689.8937 -18.6 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 LLYDLNIVNQSQLR + 2 Deamidated (NQ)
1696 991.4821 990.4748 990.4627 12.3 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 SPCVMIER
2184 557.7593 1113.5040 1113.5012 2.55 1 2 2.6 +1Score > 19 indicates identity YIDDGMQKK + Deamidated (NQ); Oxidation (M)
3021 801.9165 1601.8184 1601.8382 -12.3 1 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 STVPIIIRCCIDR
4227 806.1079 2415.3019 2415.2686 13.8 1 2 2.1 +1Score > 18 indicates identity AIFPNTVDGDLLKLVHLSNGYK + 2 Deamidated (NQ)
2958 782.3701 1562.7256 1562.7424 -10.7 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 LEGRGTETEESINK + Deamidated (NQ)
4100 1152.0632 2302.1118 2302.1515 -17.2 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 LSMESPHVNVFSILTDLDIR + Deamidated (NQ); Oxidation (M)
2127 551.2817 1100.5488 1100.5462 2.44 0 2 0.95 +1Score > 21 indicates identity
Score > 14 indicates homology		 NNNVEELLR + Deamidated (NQ)
1441 456.2181 910.4216 910.4396 -19.7 0 2 2.2 +1Score > 18 indicates identity NQLGSTYK + Deamidated (NQ)
2924 516.2711 1545.7915 1545.8038 -8.01 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 AENVEPNYGITVIK
4497 992.8351 2975.4835 2975.5202 -12.3 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 KNTTYVATLIYEFIILNDASMTPDVK + Oxidation (M)
1012 339.6645 677.3144 677.3166 -3.25 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 MSTPAR + Oxidation (M)
1216 808.3997 807.3924 807.3987 -7.79 1 2 3 +1Score > 19 indicates identity NKNYNR
1385 891.4409 890.4336 890.4280 6.32 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 LGPQSMSR + Oxidation (M)
3378 463.9709 1851.8545 1851.8275 14.6 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 IVQSWYNDLDVNDDR + Deamidated (NQ)
1527 470.2545 938.4944 938.4821 13.1 1 2 3 +1Score > 19 indicates identity YNRTASVK + Deamidated (NQ)
2847 750.8644 1499.7142 1499.7157 -0.98 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 YHSHNDTIFIPR + Deamidated (NQ)
2542 611.8279 1221.6412 1221.6209 16.6 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 MSKVMKPSNGK + Oxidation (M)
1878 521.7630 1041.5114 1041.4913 19.3 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 EKAPMDSHK
1853 517.7680 1033.5214 1033.5193 2.12 0 2 1 +1Score > 24 indicates identity
Score > 15 indicates homology		 QPFTVSNNK
2188 558.2607 1114.5068 1114.5155 -7.81 0 2 2.4 +1Score > 18 indicates identity INQWSSHSR + Deamidated (NQ)
3238 876.4580 1750.9014 1750.9288 -15.6 0 2 0.7 +1Score > 22 indicates identity
Score > 13 indicates homology		 MTGFVNIVNSTLSVLR + Deamidated (NQ)
4203 797.4354 2389.2844 2389.2839 0.20 0 2 2.4 +1Score > 18 indicates identity EQISSLIDSLLLNSTNLSSLLK + 2 Deamidated (NQ)
2025 540.2615 1078.5084 1078.4931 14.3 0 2 0.91 +1Score > 22 indicates identity
Score > 14 indicates homology		 GNQFLQENK + 2 Deamidated (NQ)
1142 386.2251 770.4356 770.4399 -5.47 1 2 2.1 +1Score > 18 indicates identity LQPRTR + Deamidated (NQ)
1861 518.7767 1035.5388 1035.5236 14.7 0 2 0.73 +1Score > 22 indicates identity
Score > 13 indicates homology		 LGSEYKPNK + Deamidated (NQ)
2626 656.8342 1311.6538 1311.6744 -15.7 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 DVKSQISMIFK + Deamidated (NQ); Oxidation (M)
1807 511.7649 1021.5152 1021.5226 -7.23 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 SITDGVMRK + Oxidation (M)
1088 742.4111 741.4038 741.4021 2.35 0 2 2.1 +1Score > 18 indicates identity AAEGPVAK
2290 571.7635 1141.5124 1141.5251 -11.1 0 2 3.3 +1Score > 19 indicates identity TASAPNSGNPPK + 2 Deamidated (NQ)
2843 749.3736 1496.7326 1496.7147 12.0 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 LDSEFQPLSSAFR + Deamidated (NQ)
3947 724.0266 2169.0580 2169.0953 -17.2 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 TNTTNSEAKVKPIESFFQK + Deamidated (NQ)
1959 1061.5109 1060.5036 1060.5050 -1.27 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 SINWRDNR + Deamidated (NQ)
2926 774.3635 1546.7124 1546.7184 -3.87 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 LNQPSNINMEEIK + 2 Deamidated (NQ); Oxidation (M)
2683 685.3210 1368.6274 1368.6265 0.71 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 SMVKVMLNDNGK + 2 Deamidated (NQ); 2 Oxidation (M)
2673 680.3725 1358.7304 1358.7154 11.1 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 IETLQLESDRR
2894 765.9070 1529.7994 1529.7937 3.76 0 2 0.95 +1Score > 23 indicates identity
Score > 14 indicates homology		 ENQVVVIIGETGSGK + Deamidated (NQ)
958 639.3466 638.3393 638.3428 -5.45 0 2 0.85 +1Score > 20 indicates identity
Score > 14 indicates homology		 FTFPK
1324 431.2202 860.4258 860.4392 -15.5 0 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 VSDLYHK
2207 560.7733 1119.5320 1119.5342 -1.93 1 2 0.81 +1Score > 21 indicates identity
Score > 13 indicates homology		 ANEAAMNKVR + Deamidated (NQ); Oxidation (M)
1082 370.7011 739.3876 739.3752 16.8 0 2 2.5 +1Score > 18 indicates identity QYSTLK + Deamidated (NQ)
1404 898.3910 897.3837 897.3716 13.5 0 2 2.4 +1Score > 18 indicates identity ADSGYEEK
3101 832.3835 1662.7524 1662.7631 -6.41 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 QVATNEMAALRNGGGR + 3 Deamidated (NQ); Oxidation (M)
3535 984.4788 1966.9430 1966.9346 4.30 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 ANPNPVKFMNTSEIFQK + 3 Deamidated (NQ)
2668 677.3414 1352.6682 1352.6460 16.5 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 GKESLQDVYDAK + Deamidated (NQ)
3595 669.0339 2004.0799 2004.0568 11.5 1 2 3 +1Score > 19 indicates identity LPPLRFLDDYIEISADK
2913 769.8653 1537.7160 1537.7233 -4.71 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 RPDNQNPEGENLR
4713 1051.2902 4201.1317 4201.0493 19.6 1 2 2.1 +1Score > 17 indicates identity SRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVR + Deamidated (NQ)
2670 677.3433 1352.6720 1352.6460 19.3 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 GKESLQDVYDAK + Deamidated (NQ)
3731 692.3422 2074.0048 2073.9829 10.5 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 LDSINLKMYNYNEQWK + Oxidation (M)
2760 723.8675 1445.7204 1445.7085 8.25 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 SHGAVLPSYCSLR
3571 664.3135 1989.9187 1989.9062 6.29 1 2 0.76 +1Score > 21 indicates identity
Score > 13 indicates homology		 KQLAQDQMSTTGSNSAGHK + 2 Deamidated (NQ)
4116 1155.0708 2308.1270 2308.0820 19.5 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 NKGLTYNDTMLYYLNLPQK + 4 Deamidated (NQ); Oxidation (M)
1985 1067.5004 1066.4931 1066.4931 0.034 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 QVSYEDGLR + Deamidated (NQ)
3635 1011.4907 2020.9668 2020.9346 16.0 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 HAMKELEQESCLLYNR + Deamidated (NQ)
1452 457.7336 913.4526 913.4440 9.50 0 2 3.2 +1Score > 19 indicates identity APCQGRPK + Deamidated (NQ)
2578 633.8231 1265.6316 1265.6140 14.0 0 2 0.83 +1Score > 23 indicates identity
Score > 13 indicates homology		 VESGLFSVDGEK
3248 880.4227 1758.8308 1758.8649 -19.4 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 IQQHNTILNSSSDFR
2211 561.7571 1121.4996 1121.5209 -19.0 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 AGGEGMCIAIK + Oxidation (M)
1746 1005.4859 1004.4786 1004.4675 11.0 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 SINHQYSR + Deamidated (NQ)
2755 723.3738 1444.7330 1444.7596 -18.3 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 SIVEPSGALSVAGMK
3261 886.9824 1771.9502 1771.9832 -18.6 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 LLDVIINNLNNKNFK + Deamidated (NQ)
873 529.2625 528.2552 528.2656 -19.6 0 1 0.72 +1Score > 13 indicates identity NNGPK
1571 951.4240 950.4167 950.4127 4.21 0 1 2.8 +1Score > 18 indicates identity GINGMSNNK + Deamidated (NQ); Oxidation (M)
2899 767.3747 1532.7348 1532.7293 3.62 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 SYKANQPSPGEMPK
2873 757.9149 1513.8152 1513.8239 -5.71 0 1 0.91 +1Score > 21 indicates identity
Score > 14 indicates homology		 QLLTDDNLLNIIK + 2 Deamidated (NQ)
4745 933.8181 5596.8649 5596.8345 5.43 1 1 0.87 +1Score > 13 indicates identity EPNRSINPDEAVAYGAAVQAAILTGDQSSTTQDLLLLDVAPLSLGIETAGGIMTK + 2 Deamidated (NQ)
3288 897.9575 1793.9004 1793.8869 7.53 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 VVNMEFPIDEATGKTK + Oxidation (M)
4510 746.8727 2983.4617 2983.4716 -3.31 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 VIEQVNSVIGSFFANERQLDDLFWR + 2 Deamidated (NQ)
4184 594.3079 2373.2025 2373.1798 9.57 1 1 0.95 +1Score > 22 indicates identity
Score > 14 indicates homology		 ASNNNIPKITNASNDLIEISIK + 5 Deamidated (NQ)
2080 1091.4924 1090.4851 1090.4938 -7.92 1 1 3.4 +1Score > 19 indicates identity SAGNGMENRR
4141 777.3741 2329.1005 2329.1260 -11.0 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 MSDNLLSLENPVVPSHYELR + Deamidated (NQ); Oxidation (M)
4727 929.2584 4641.2556 4641.1787 16.6 0 1 3 +1Score > 19 indicates identity MLANLLVMAGADHVVSMDLHASQMQGFFTKPVDNLYGGPSLAK + 4 Deamidated (NQ); 4 Oxidation (M)
3035 404.9314 1615.6965 1615.6818 9.11 1 1 3.2 +1Score > 19 indicates identity TEGGPSSEMSTSMKR + 2 Oxidation (M)
1638 969.4744 968.4671 968.4749 -8.06 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 MAAVRDYK + Oxidation (M)
1671 982.4740 981.4667 981.4628 4.01 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 QPSRNDHK + Deamidated (NQ)
3186 862.9020 1723.7894 1723.8199 -17.7 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 RISNQFNQQLAEMK + 2 Deamidated (NQ); Oxidation (M)
4567 1034.8253 3101.4541 3101.4757 -6.97 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 FYQKNDTLDDLNSVFISQSGYLLQYK + 3 Deamidated (NQ)
1440 910.4531 909.4458 909.4444 1.62 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 SLDEVGYK
2568 629.3219 1256.6292 1256.6071 17.7 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 NQMAHLVDLAK + 2 Deamidated (NQ); Oxidation (M)
875 531.2421 530.2348 530.2449 -18.9 0 1 0.75 +1Score > 13 indicates identity GPNSR + Deamidated (NQ)
1086 742.3378 741.3305 741.3333 -3.80 0 1 2.1 +1Score > 17 indicates identity GEFFNK + Deamidated (NQ)
2316 1148.5562 1147.5489 1147.5543 -4.69 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 NMTKIDSPDK
2499 1194.5527 1193.5454 1193.5313 11.9 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 YQDLQENQR + Deamidated (NQ)
3057 407.9467 1627.7577 1627.7399 10.9 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 TQGYTVADCTAEAIK + Deamidated (NQ)
1032 345.1887 688.3628 688.3504 18.1 0 1 0.98 +1Score > 24 indicates identity
Score > 14 indicates homology		 NVETAR
2044 1083.5278 1082.5205 1082.5284 -7.29 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 SIQNFTPFK + 2 Deamidated (NQ)
3933 721.7215 2162.1427 2162.1041 17.8 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 DLDAPRPPLPQPMKQEVSK + Deamidated (NQ); Oxidation (M)
4309 850.1016 2547.2830 2547.2566 10.3 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 YVAEATGNFITVMDALKLNYNAK + 2 Deamidated (NQ)
Page: Previous 1 2 3 4 5 6 7 8 9 10 … 48 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/