MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 4 |
| MS data file | : | PRT1245_Other_P1_B12.mgf |
| Database | : | S-cerevisiae-S288C 20191206 (6,886 sequences; 3,133,934 residues) |
| Timestamp | : | 24 Jun 2025 at 21:22:18 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,772 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 3332 |
912.4158 | 1822.8170 | 1822.8155 | 0.83 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
NNFKIIDSHSMNNSGK + 2 Deamidated (NQ); Oxidation (M) |
| 2384 |
582.2949 | 1162.5752 | 1162.5982 | -19.8 | 0 | 4 | 0.73 | 1Score > 23 indicates identity Score > 15 indicates homology |
LQTNQIFNGK + Deamidated (NQ) |
| 981 |
328.1926 | 654.3706 | 654.3701 | 0.90 | 0 | 4 | 0.58 | 1Score > 14 indicates identity |
TAAPAPK |
| 1516 |
938.4218 | 937.4145 | 937.4215 | -7.45 | 0 | 4 | 2.1 | 1Score > 20 indicates identity |
WAVNTLMS + Deamidated (NQ); Oxidation (M) |
| 1729 |
999.4761 | 998.4688 | 998.4781 | -9.32 | 0 | 4 | 2.1 | 1Score > 20 indicates identity |
EGVGPNVGDR |
| 2459 |
1180.5582 | 1179.5509 | 1179.5706 | -16.7 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
ASYNPIMTQR |
| 1128 |
762.3447 | 761.3374 | 761.3378 | -0.45 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
ENSGPMK |
| 4222 |
804.7550 | 2411.2432 | 2411.2067 | 15.1 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
IEAALSDALAALQIEDPSADELR + Deamidated (NQ) |
| 2063 |
544.2852 | 1086.5558 | 1086.5570 | -1.09 | 1 | 4 | 0.88 | 1Score > 22 indicates identity Score > 16 indicates homology |
DGLLGWDRR |
| 2624 |
656.2980 | 1310.5814 | 1310.6037 | -17.0 | 1 | 4 | 2 | 1Score > 19 indicates identity |
DHHKMAISDGGK + Oxidation (M) |
| 3350 |
460.2230 | 1836.8629 | 1836.8490 | 7.58 | 0 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
DVGQDGLQAAISYATGNR + 2 Deamidated (NQ) |
| 3005 |
530.9439 | 1589.8099 | 1589.7970 | 8.08 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
EAQRIEGMLQLLTS + 2 Deamidated (NQ) |
| 1318 |
430.2115 | 858.4084 | 858.4083 | 0.20 | 0 | 4 | 1.7 | 1Score > 18 indicates identity |
DANGKPEK + Deamidated (NQ) |
| 1312 |
858.4193 | 857.4120 | 857.4171 | -5.88 | 0 | 4 | 1.6 | 1Score > 18 indicates identity |
YLSNIFT + Deamidated (NQ) |
| 1063 |
724.4109 | 723.4036 | 723.4140 | -14.3 | 1 | 4 | 1.5 | 1Score > 18 indicates identity |
GNKHLR |
| 2135 |
1103.5082 | 1102.5009 | 1102.5142 | -12.0 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
EGGETQEKPK + Deamidated (NQ) |
| 1307 |
428.7305 | 855.4464 | 855.4338 | 14.8 | 0 | 4 | 1.6 | 1Score > 18 indicates identity |
TPETSPPK |
| 3020 |
801.9153 | 1601.8160 | 1601.8382 | -13.8 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
STVPIIIRCCIDR |
| 2739 |
717.3445 | 1432.6744 | 1432.7020 | -19.2 | 1 | 4 | 0.67 | 1Score > 21 indicates identity Score > 14 indicates homology |
MSFNAFASSLSKK + Oxidation (M) |
| 3683 |
685.0151 | 2052.0235 | 2052.0561 | -15.9 | 1 | 3 | 0.67 | 1Score > 21 indicates identity Score > 14 indicates homology |
VINKCTSDIQLNSGIVYK + Deamidated (NQ) |
| 3780 |
1045.9911 | 2089.9676 | 2089.9803 | -6.08 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
LNLNNKPSQQQFSDPETK + 3 Deamidated (NQ) |
| 3974 |
731.6685 | 2191.9837 | 2191.9954 | -5.35 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
NANLNNSRNANAPGEAGHQNK + 2 Deamidated (NQ) |
| 1263 |
419.2062 | 836.3978 | 836.4140 | -19.4 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
HLDAEPR |
| 1618 |
966.4652 | 965.4579 | 965.4679 | -10.3 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
LSHENNPR |
| 2266 |
1137.5419 | 1136.5346 | 1136.5132 | 18.9 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
AAERDNMLTT + Oxidation (M) |
| 1908 |
524.7842 | 1047.5538 | 1047.5634 | -9.12 | 0 | 3 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
NIVNLMISK + Deamidated (NQ); Oxidation (M) |
| 1140 |
385.1961 | 768.3776 | 768.3878 | -13.2 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
GNKANHK + Deamidated (NQ) |
| 2654 |
667.8423 | 1333.6700 | 1333.6547 | 11.5 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
MALGNEINITNK + Deamidated (NQ); Oxidation (M) |
| 3042 |
810.4078 | 1618.8010 | 1618.7739 | 16.7 | 0 | 3 | 0.52 | 1Score > 23 indicates identity Score > 13 indicates homology |
LITAYYNEHGPGQR + Deamidated (NQ) |
| 963 |
321.1849 | 640.3552 | 640.3657 | -16.3 | 0 | 3 | 0.95 | 1Score > 16 indicates identity |
VGVNPR |
| 1071 |
728.3975 | 727.3902 | 727.3977 | -10.3 | 0 | 3 | 1.3 | 1Score > 17 indicates identity |
AVPGATGR |
| 3564 |
992.9846 | 1983.9546 | 1983.9497 | 2.48 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
TALQQQIHAAQQATNTTR + 4 Deamidated (NQ) |
| 1467 |
460.7513 | 919.4880 | 919.4909 | -3.12 | 1 | 3 | 0.88 | 1Score > 21 indicates identity Score > 15 indicates homology |
MTQRQLK + Oxidation (M) |
| 1430 |
907.4361 | 906.4288 | 906.4406 | -13.0 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
NKDSASASK |
| 2864 |
504.2526 | 1509.7360 | 1509.7212 | 9.78 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
GVERPSTPFSDYR |
| 1223 |
406.2201 | 810.4256 | 810.4348 | -11.3 | 0 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
VSPNAAPR |
| 3616 |
1006.5054 | 2010.9962 | 2011.0149 | -9.29 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
LYQEEDLKNFEIQTLK + Deamidated (NQ) |
| 3399 |
621.6647 | 1861.9723 | 1861.9898 | -9.40 | 0 | 3 | 0.77 | 1Score > 21 indicates identity Score > 15 indicates homology |
VVSQSQIIFTTNIAAGGR + Deamidated (NQ) |
| 2653 |
667.8421 | 1333.6696 | 1333.6547 | 11.2 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
VENGIMQSISEK |
| 4685 |
892.4351 | 3565.7113 | 3565.7093 | 0.55 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
GVQSPPKPPPSNEISGTIENDVESIKQAADNMAK + 2 Deamidated (NQ); Oxidation (M) |
| 1372 |
884.4353 | 883.4280 | 883.4148 | 15.0 | 0 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
TVQNHQR + 2 Deamidated (NQ) |
| 2800 |
733.3707 | 1464.7268 | 1464.7361 | -6.32 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
YALATGNWGEQKK |
| 1471 |
921.4510 | 920.4437 | 920.4273 | 17.8 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
SMENVTPK + Oxidation (M) |
| 3530 |
655.6334 | 1963.8784 | 1963.9044 | -13.3 | 0 | 3 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
AANLGGVAVSGLEMAQNSQK + 4 Deamidated (NQ); Oxidation (M) |
| 1276 |
842.4385 | 841.4312 | 841.4406 | -11.1 | 1 | 3 | 1.6 | 1Score > 18 indicates identity |
QNPAERK |
| 1446 |
911.4600 | 910.4527 | 910.4508 | 2.09 | 1 | 3 | 2.4 | 1Score > 20 indicates identity |
ETYNTKR |
| 1201 |
400.7176 | 799.4206 | 799.4301 | -11.8 | 0 | 3 | 1.9 | 1Score > 18 indicates identity |
LLGGGGGGGR |
| 937 |
312.1794 | 622.3442 | 622.3551 | -17.4 | 0 | 3 | 0.9 | 1Score > 22 indicates identity Score > 15 indicates homology |
HNKPK |
| 2134 |
552.2557 | 1102.4968 | 1102.5142 | -15.7 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
EGGETQEKPK + Deamidated (NQ) |
| 1267 |
420.7331 | 839.4516 | 839.4501 | 1.84 | 0 | 3 | 1.9 | 1Score > 18 indicates identity |
NATPVNPK |
| 1304 |
855.4029 | 854.3956 | 854.3882 | 8.66 | 0 | 3 | 1.7 | 1Score > 18 indicates identity |
NSSYTQR |
| 1803 |
511.2798 | 1020.5450 | 1020.5492 | -4.03 | 0 | 3 | 0.81 | 1Score > 22 indicates identity Score > 15 indicates homology |
VTLFNTTPK + Deamidated (NQ) |
| 3130 |
842.9015 | 1683.7884 | 1683.7661 | 13.3 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
QIQEYESMNGNLIK + 2 Deamidated (NQ); Oxidation (M) |
| 1718 |
498.7426 | 995.4706 | 995.4712 | -0.58 | 0 | 3 | 0.82 | 1Score > 21 indicates identity Score > 15 indicates homology |
LEFGNYPR + Deamidated (NQ) |
| 2087 |
1092.5162 | 1091.5089 | 1091.5108 | -1.72 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
QPPETNHNR |
| 2888 |
764.3556 | 1526.6966 | 1526.7221 | -16.7 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
GNSMLFTMNRDIK + Deamidated (NQ) |
| 982 |
328.1929 | 654.3712 | 654.3701 | 1.80 | 0 | 3 | 0.71 | 1Score > 14 indicates identity |
SVPAPGK |
| 1530 |
940.4722 | 939.4649 | 939.4484 | 17.6 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
FNKMNLR + 2 Deamidated (NQ); Oxidation (M) |
| 3696 |
515.2592 | 2057.0077 | 2057.0331 | -12.3 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
EPGTVFHVQQLGFTLNDR |
| 2967 |
524.2629 | 1569.7669 | 1569.7787 | -7.54 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
HDPLNSNIFSEAVK |
| 2226 |
1125.5323 | 1124.5250 | 1124.5396 | -13.0 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
AEPRHMQQK + Deamidated (NQ) |
| 2928 |
774.4020 | 1546.7894 | 1546.7892 | 0.15 | 1 | 3 | 0.79 | 1Score > 22 indicates identity Score > 14 indicates homology |
GLVVSPYDYNHKR |
| 1517 |
469.7158 | 937.4170 | 937.4327 | -16.7 | 1 | 3 | 2.6 | 1Score > 20 indicates identity |
GEMKSGWK + Oxidation (M) |
| 4498 |
992.8351 | 2975.4835 | 2975.4288 | 18.4 | 0 | 3 | 0.77 | 1Score > 21 indicates identity Score > 14 indicates homology |
TIHIIEVDESFDATLSDDVVDQWLSK + Deamidated (NQ) |
| 1112 |
757.4155 | 756.4082 | 756.4018 | 8.54 | 0 | 3 | 2.5 | 1Score > 19 indicates identity |
TSPLPDK |
| 1717 |
996.4777 | 995.4704 | 995.4560 | 14.5 | 0 | 3 | 0.65 | 1Score > 21 indicates identity Score > 13 indicates homology |
QGLEGNSYK + Deamidated (NQ) |
| 2912 |
769.8645 | 1537.7144 | 1537.7233 | -5.75 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
RPDNQNPEGENLR |
| 2895 |
765.9095 | 1529.8044 | 1529.8300 | -16.7 | 1 | 3 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
KISQLVQENVTLR + 3 Deamidated (NQ) |
| 1555 |
948.4549 | 947.4476 | 947.4308 | 17.8 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
NNESNNKK + Deamidated (NQ) |
| 4114 |
1154.5721 | 2307.1296 | 2307.0980 | 13.7 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
NKGLTYNDTMLYYLNLPQK + 3 Deamidated (NQ); Oxidation (M) |
| 1181 |
794.3692 | 793.3619 | 793.3640 | -2.61 | 0 | 3 | 0.72 | 1Score > 21 indicates identity Score > 14 indicates homology |
QLGDSMK + Oxidation (M) |
| 4231 |
809.3671 | 2425.0795 | 2425.1049 | -10.5 | 1 | 3 | 2.4 | 1Score > 19 indicates identity |
LMENHACNGLTSCKEQLHQR |
| 3641 |
1013.4971 | 2024.9796 | 2024.9837 | -1.98 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
NIGVADPQNSLNPSKPNMK + 2 Deamidated (NQ) |
| 1158 |
391.2019 | 780.3892 | 780.3766 | 16.2 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
PAPQDPR + Deamidated (NQ) |
| 3162 |
852.9709 | 1703.9272 | 1703.9260 | 0.75 | 0 | 3 | 2.4 | 1Score > 19 indicates identity |
QHIHYLNLLIHFR + Deamidated (NQ) |
| 1995 |
1068.5188 | 1067.5115 | 1067.5247 | -12.4 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
HQPITSEQK + Deamidated (NQ) |
| 3269 |
889.4378 | 1776.8610 | 1776.8936 | -18.3 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
ILQMGAIMNLGMPSRK + 2 Deamidated (NQ); Oxidation (M) |
| 4074 |
761.0724 | 2280.1954 | 2280.1824 | 5.70 | 0 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
GMILGNFSILVASYANEVIPR + Deamidated (NQ); Oxidation (M) |
| 2714 |
703.3409 | 1404.6672 | 1404.6885 | -15.1 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
NPGSINIYEIER + Deamidated (NQ) |
| 2508 |
600.2719 | 1198.5292 | 1198.5466 | -14.4 | 1 | 3 | 2.3 | 1Score > 19 indicates identity |
EPKNENDEPK |
| 4229 |
808.1061 | 2421.2965 | 2421.2863 | 4.19 | 1 | 3 | 1.5 | 1Score > 17 indicates identity |
LLIGKSSNSHSTDSATLVNVHIK + Deamidated (NQ) |
| 2959 |
782.3888 | 1562.7630 | 1562.7551 | 5.07 | 1 | 3 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
DFLSIRYSMPYR + Oxidation (M) |
| 4256 |
819.4179 | 2455.2319 | 2455.2496 | -7.20 | 1 | 3 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
GLPSEKIHDVLGYSVSEYVAHR |
| 4101 |
1152.0642 | 2302.1138 | 2302.1515 | -16.4 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
LSMESPHVNVFSILTDLDIR + Deamidated (NQ); Oxidation (M) |
| 1048 |
701.3663 | 700.3590 | 700.3504 | 12.3 | 0 | 3 | 1.2 | 1Score > 16 indicates identity |
ASNQPGK |
| 2642 |
664.8313 | 1327.6480 | 1327.6408 | 5.46 | 0 | 3 | 0.61 | 1Score > 22 indicates identity Score > 13 indicates homology |
NSATILNYFER + Deamidated (NQ) |
| 953 |
634.3574 | 633.3501 | 633.3520 | -2.92 | 0 | 3 | 0.81 | 1Score > 22 indicates identity Score > 14 indicates homology |
VGSLMK |
| 3435 |
473.9743 | 1891.8681 | 1891.8986 | -16.1 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
DSCKNIEPIDTPISFR + Deamidated (NQ) |
| 4600 |
1070.8766 | 3209.6080 | 3209.6642 | -17.5 | 1 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
EASEILAGLQGILPMDISVHQVDGGLKVYR + 2 Deamidated (NQ) |
| 931 |
618.2739 | 617.2666 | 617.2769 | -16.6 | 0 | 2 | 0.65 | 1Score > 13 indicates identity |
QQGER + Deamidated (NQ) |
| 1187 |
398.2225 | 794.4304 | 794.4174 | 16.4 | 0 | 2 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
GVEYSLK |
| 2818 |
740.3571 | 1478.6996 | 1478.7286 | -19.6 | 1 | 2 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
TSMSIIDDENVKK |
| 3094 |
828.9061 | 1655.7976 | 1655.7647 | 19.9 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
EGAQLYSCAKCQLK + Deamidated (NQ) |
| 3541 |
656.9966 | 1967.9680 | 1967.9550 | 6.59 | 1 | 2 | 0.62 | 1Score > 22 indicates identity Score > 13 indicates homology |
LTNEDPPGLMYLKAFDK + Deamidated (NQ); Oxidation (M) |
| 4703 |
934.2245 | 3732.8689 | 3732.8808 | -3.19 | 1 | 2 | 2.7 | 1Score > 19 indicates identity |
IKQVSLTNLQDDWMGVILVNSTQSDPLINTPFK + 3 Deamidated (NQ); Oxidation (M) |
| 3864 |
708.6938 | 2123.0596 | 2123.0351 | 11.5 | 1 | 2 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
LNRQGTMVATCSVQGTLIR + 3 Deamidated (NQ); Oxidation (M) |
| 1313 |
858.4222 | 857.4149 | 857.4171 | -2.50 | 0 | 2 | 2 | 1Score > 18 indicates identity |
YLSNIFT + Deamidated (NQ) |
| 2717 |
705.8546 | 1409.6946 | 1409.7006 | -4.25 | 1 | 2 | 0.79 | 1Score > 21 indicates identity Score > 14 indicates homology |
NTNISIMRLGMK + Deamidated (NQ); 2 Oxidation (M) |
| 1431 |
907.4511 | 906.4438 | 906.4308 | 14.4 | 0 | 2 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
NSNVSHHL |
| 3144 |
564.2997 | 1689.8773 | 1689.8542 | 13.7 | 1 | 2 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
KIICPSVESISNGMR |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/