MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 3
MS data file : PRT1245_Other_P1_B11.mgf
Database : S-cerevisiae-S288C 20191206 (6,886 sequences; 3,133,934 residues)
Timestamp : 24 Jun 2025 at 21:21:58 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,722

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 501–600 (out of 4645)


Page: Previous 1 2 3 4 5 6 7 8 9 10 11  47 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2558 643.8303 1285.6460 1285.6374 6.70 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
INGNGKNNIDAR + Deamidated (NQ)
2472 600.2755 1198.5364 1198.5466 -8.43 1 1 3.6 +1Score > 19 indicates identity EPKNENDEPK
3097 564.6341 1690.8805 1690.8566 14.1 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
DDFAYIIELIQSHK
2911 523.9290 1568.7652 1568.7617 2.23 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
MNNTSITGPQVLHR + 2 Deamidated (NQ)
2899 781.8989 1561.7832 1561.8100 -17.1 1 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology
DINDININFAAKSK
3117 855.4347 1708.8548 1708.8492 3.30 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
NSIRSIINHPEDSAR + Deamidated (NQ)
3163 581.6651 1741.9735 1741.9403 19.1 1 1 2.4 +1Score > 17 indicates identity QIFLPNKQHFLDIK + 2 Deamidated (NQ)
3411 972.4617 1942.9088 1942.9266 -9.12 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
KSTSSSINSISNMGTSAVR + Deamidated (NQ); Oxidation (M)
2632 677.3454 1352.6762 1352.6572 14.1 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
KLENDYTSLNR + Deamidated (NQ)
2173 560.7740 1119.5334 1119.5342 -0.69 1 1 0.91 +1Score > 21 indicates identity
Score > 13 indicates homology
NAENGQMTKK
2260 571.7637 1141.5128 1141.5251 -10.7 0 1 4.2 +1Score > 19 indicates identity TASAPNSGNPPK + 2 Deamidated (NQ)
1135 371.1809 740.3472 740.3453 2.64 0 1 2.4 +1Score > 17 indicates identity HNNDLK + Deamidated (NQ)
3856 1085.5380 2169.0614 2169.0841 -10.4 1 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology
SAEYSLKEIQIEELQDFK
4364 963.1185 2886.3337 2886.3878 -18.7 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
NITGISNSELLSEMNNDISMFGILLK + 2 Deamidated (NQ); 2 Oxidation (M)
1227 800.3809 799.3736 799.3864 -16.0 0 1 2.1 +1Score > 16 indicates identity YNYAIR + Deamidated (NQ)
1580 950.4611 949.4538 949.4716 -18.7 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
LSDGSSEKK
3853 1083.9905 2165.9664 2165.9600 2.97 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
GQLDLINDGEGSLSNFADNGK + 3 Deamidated (NQ)
4667 902.0750 4505.3386 4505.2846 12.0 1 1 1.9 +1Score > 16 indicates identity TILDIVNIQNELSNHLTVQSQNINLMLNNQDDIELNIKK + 4 Deamidated (NQ)
1798 1021.5449 1020.5376 1020.5240 13.3 0 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
ETALDFIGR
2647 687.3440 1372.6734 1372.6697 2.75 0 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
LSLDSFFEMIR + Oxidation (M)
2869 513.5782 1537.7128 1537.6871 16.7 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
YEKMFYNQAATR + Deamidated (NQ); Oxidation (M)
3148 868.4635 1734.9124 1734.9021 5.96 0 1 0.97 +1Score > 21 indicates identity
Score > 13 indicates homology
ILFQYWLFYNSLK + Deamidated (NQ)
1581 950.4705 949.4632 949.4756 -13.1 0 1 0.97 +1Score > 22 indicates identity
Score > 13 indicates homology
NNVVINFK + 3 Deamidated (NQ)
3370 952.4506 1902.8866 1902.9058 -10.1 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
KNGSQEQELGDIVDEIK + 2 Deamidated (NQ)
4604 1184.8998 3551.6776 3551.7429 -18.4 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
IAYTFGWEGPALTVDTACSSSLVGIHLAMQALR + Deamidated (NQ); Oxidation (M)
2905 781.9234 1561.8322 1561.8028 18.9 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
GILNYYKLATNYK + 2 Deamidated (NQ)
3491 998.4747 1994.9348 1994.9619 -13.6 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
GIVDIYSNDVMIIDNNGK + Oxidation (M)
3499 668.7001 2003.0785 2003.0840 -2.76 1 1 4.1 +1Score > 19 indicates identity FQAERGLDVLVLLTSWR + Deamidated (NQ)
2237 568.8420 1135.6694 1135.6601 8.22 1 1 1.1 +1Score > 14 indicates identity KTQVYTGIVK
4274 917.1353 2748.3841 2748.3316 19.1 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
NAAWLVFANKQDLPEAMSAAEITEK + 2 Deamidated (NQ)
1063 339.6647 677.3148 677.3166 -2.66 0 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
MSTPAR + Oxidation (M)
1142 743.4055 742.3982 742.3974 1.17 0 1 2.9 +1Score > 18 indicates identity QGGSAPVK
2069 547.7656 1093.5166 1093.5186 -1.77 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
SQVSQNRMK + Deamidated (NQ); Oxidation (M)
3618 689.3560 2065.0462 2065.0102 17.4 1 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology
AVYENNETGVIKNLELQK + 4 Deamidated (NQ)
4107 802.0816 2403.2230 2403.2091 5.79 0 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology
VNIALAELLTVSTDDTDMPLEK + Oxidation (M)
4650 821.2094 4101.0106 4101.0214 -2.62 0 0 4 +1Score > 19 indicates identity IMLVFVIIDGITSNESILDMSQVNYIPDQYGNPQLK + 2 Deamidated (NQ); 2 Oxidation (M)
4077 594.3049 2373.1905 2373.2151 -10.4 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
FYRVVNMSFGGDTNLILAALR + Deamidated (NQ); Oxidation (M)
1853 518.7766 1035.5386 1035.5284 9.91 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
LGHPCPLSR
2532 631.3194 1260.6242 1260.6197 3.59 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
GKQIESEGGNLK + 2 Deamidated (NQ)
1890 524.7632 1047.5118 1047.5026 8.86 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
GPFNWTVEV
2524 628.3115 1254.6084 1254.6278 -15.4 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
YMEQIKGTGTK
1628 967.4886 966.4813 966.4844 -3.22 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
KGIQMFDK + Deamidated (NQ)
3162 581.6646 1741.9720 1741.9978 -14.8 0 0 2.6 +1Score > 17 indicates identity FAASIPSVVNVLDAVIK
1462 911.4603 910.4530 910.4621 -9.93 1 0 4.5 +1Score > 20 indicates identity KHATPSDR
2975 534.9495 1601.8267 1601.8382 -7.17 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
STVPIIIRCCIDR
2391 585.7833 1169.5520 1169.5313 17.8 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
ADPTNGPAENGK
2995 810.4095 1618.8044 1618.7872 10.6 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology
EQQQLGMLDDKVAK + Deamidated (NQ); Oxidation (M)
1217 398.2102 794.4058 794.4174 -14.6 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
VSTTYPK
4033 777.3722 2329.0948 2329.1260 -13.4 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
MSDNLLSLENPVVPSHYELR + Deamidated (NQ); Oxidation (M)
1014 315.6646 629.3146 629.3133 2.18 0 0 1.6 +1Score > 15 indicates identity TAQPGR + Deamidated (NQ)
2901 781.9012 1561.7878 1561.7592 18.3 0 0 0.98 +1Score > 23 indicates identity
Score > 13 indicates homology
IICPSVESISNGMR
4024 775.4034 2323.1884 2323.1478 17.5 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
TIMNIDATTEGENLHVLSPPR + Oxidation (M)
1621 483.7363 965.4580 965.4753 -17.8 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
IATRGAFAC
4100 600.5532 2398.1837 2398.1917 -3.34 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology
QPGHTDWAVIQLGRESSFIEK + Deamidated (NQ)
2090 550.2736 1098.5326 1098.5458 -12.0 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
TYYLQGAQR
1589 953.4348 952.4275 952.4362 -9.14 1 0 3.8 +1Score > 19 indicates identity DAYRGQSR + Deamidated (NQ)
4063 1183.5724 2365.1302 2365.1471 -7.11 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology
SMNLLQELSPRLFEAANASEK + 2 Deamidated (NQ); Oxidation (M)
2691 716.3846 1430.7546 1430.7518 2.02 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
IGAWASRQSDVIK + Deamidated (NQ)
2800 749.3730 1496.7314 1496.7147 11.2 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
LDSEFQPLSSAFR + Deamidated (NQ)
2812 752.8723 1503.7300 1503.7425 -8.31 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
SPTGIVLMNMGGPSK + Oxidation (M)
1089 349.1982 696.3818 696.3919 -14.4 0 0 1.6 +1Score > 15 indicates identity SVNHLK
2336 579.7607 1157.5068 1157.5274 -17.8 0 0 3.7 +1Score > 18 indicates identity GNYMLVSQTK + 2 Deamidated (NQ); Oxidation (M)
4413 992.8385 2975.4937 2975.5202 -8.90 1 0 0.96 +1Score > 21 indicates identity
Score > 13 indicates homology
KNTTYVATLIYEFIILNDASMTPDVK + Oxidation (M)
4709 1124.8068 5618.9976 5618.9967 0.16 1 0 0.92 +1Score > 13 indicates identity AMVLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYK + Deamidated (NQ)
1230 400.7171 799.4196 799.4188 1.05 0 0 3.6 +1Score > 18 indicates identity QKPDQGK
2658 695.3385 1388.6624 1388.6831 -14.8 0 0 0.96 +1Score > 21 indicates identity
Score > 13 indicates homology
NGMVVGLGAGQQSR + Oxidation (M)
2900 521.6019 1561.7839 1561.7997 -10.1 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology
VLQTMSFLMNHLI + Oxidation (M)
2952 794.9087 1587.8028 1587.8256 -14.3 1 0 1 +1Score > 24 indicates identity
Score > 13 indicates homology
AAQNPLADIQVYKR + 2 Deamidated (NQ)
3328 622.6384 1864.8934 1864.8625 16.6 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
EEAGAANEQMPYNKAVK + Oxidation (M)
4676 940.6689 4698.3081 4698.2518 12.0 1 0 3.8 +1Score > 19 indicates identity FQKPYNPLAMDSYALGIMLITMINNIIPFIDSCNTDARFR + 3 Deamidated (NQ); 2 Oxidation (M)
2305 1152.5498 1151.5425 1151.5346 6.86 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
ITDDNEIGFK + Deamidated (NQ)
3100 847.3828 1692.7510 1692.7559 -2.89 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
ETSNKQTACPICQR + Deamidated (NQ)
4339 943.8542 2828.5408 2828.5840 -15.3 1 0 1.7 +1Score > 15 indicates identity TLIFSRFSFNLVLLAVVDYQIITR + Deamidated (NQ)
2753 732.3587 1462.7028 1462.6973 3.77 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
SLNTNSPISELCK + Deamidated (NQ)
2499 610.2943 1218.5740 1218.5564 14.5 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
GKSANFCGNHK
3342 469.9762 1875.8757 1875.9115 -19.1 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
REPFFHGTSNTDQLVK + Deamidated (NQ)
2923 788.3784 1574.7422 1574.7576 -9.77 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
SGVQTAYIDYSSKR + Deamidated (NQ)
4285 922.1370 2763.3892 2763.4402 -18.5 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology
SLNELSLSDILIAADVEGGLHAVDRR + Deamidated (NQ)
2619 672.8279 1343.6412 1343.6510 -7.25 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
DGEWLYHISPK
2935 789.9206 1577.8266 1577.8487 -14.0 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
LKFASNLMVINPSK + Deamidated (NQ); Oxidation (M)
3147 868.4271 1734.8396 1734.8617 -12.7 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
ERNYIVAFIFGNYK + 2 Deamidated (NQ)
3179 584.6035 1750.7887 1750.8009 -7.00 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
QPDDIINNDEPSHKK + 2 Deamidated (NQ)
3655 1039.5046 2076.9946 2077.0361 -20.0 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
SLDELCGVQLTSTLRQQK + 2 Deamidated (NQ)
3905 739.3282 2214.9628 2214.9742 -5.14 1 0 3.8 +1Score > 18 indicates identity VQLCTLMNIKSGGCSEDCK + Oxidation (M)
4529 1079.8875 3236.6407 3236.6324 2.57 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
QSASVTLWQVIGNSVMAFILGSMFYKVMK + 2 Deamidated (NQ)
3070 836.9415 1671.8684 1671.8679 0.32 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
SIPPVTSSIQAQQSTK + Deamidated (NQ)
2541 636.3044 1270.5942 1270.5789 12.1 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
NGQASAPRPNQK + 4 Deamidated (NQ)
3426 976.9856 1951.9566 1951.9350 11.1 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
EEAAPKPPSSAVFSMFGGK + Oxidation (M)
3589 1029.4906 2056.9666 2056.9371 14.4 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
SMTPFSAGNTSSQNKLENK + Deamidated (NQ); Oxidation (M)
2898 521.5998 1561.7776 1561.7997 -14.1 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology
VLQTMSFLMNHLI + Oxidation (M)
1957 1064.5415 1063.5342 1063.5410 -6.40 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology
RTAQFEANK
2482 603.7983 1205.5820 1205.5962 -11.7 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
IGIETNMLGDK + Oxidation (M)
1 300.0932 299.0859
2 300.2087 299.2014
3 301.1169 300.1096
4 301.1435 300.1362
5 301.1435 300.1362
6 301.1435 300.1362
7 301.1436 300.1363
8 301.1438 300.1365
Page: Previous 1 2 3 4 5 6 7 8 9 10 11  47 Next 

Not what you expected? Try the select summary.