| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 3 |
| MS data file | : | PRT1245_Other_P1_B11.mgf |
| Database | : | S-cerevisiae-S288C 20191206 (6,886 sequences; 3,133,934 residues) |
| Timestamp | : | 24 Jun 2025 at 21:21:58 GMT |
Not what you expected? Try
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | |
| Variable modifications | : | |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,722 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 | 2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | ||||
| 6.2e-007 | 1 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | ||||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle (
) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 643.8303 | 1285.6460 | 1285.6374 | 6.70 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
INGNGKNNIDAR + Deamidated (NQ) | |
| 600.2755 | 1198.5364 | 1198.5466 | -8.43 | 1 | 1 | 3.6 | 1Score > 19 indicates identity |
EPKNENDEPK | |
| 564.6341 | 1690.8805 | 1690.8566 | 14.1 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
DDFAYIIELIQSHK | |
| 523.9290 | 1568.7652 | 1568.7617 | 2.23 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
MNNTSITGPQVLHR + 2 Deamidated (NQ) | |
| 781.8989 | 1561.7832 | 1561.8100 | -17.1 | 1 | 1 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
DINDININFAAKSK | |
| 855.4347 | 1708.8548 | 1708.8492 | 3.30 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
NSIRSIINHPEDSAR + Deamidated (NQ) | |
| 581.6651 | 1741.9735 | 1741.9403 | 19.1 | 1 | 1 | 2.4 | 1Score > 17 indicates identity |
QIFLPNKQHFLDIK + 2 Deamidated (NQ) | |
| 972.4617 | 1942.9088 | 1942.9266 | -9.12 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
KSTSSSINSISNMGTSAVR + Deamidated (NQ); Oxidation (M) | |
| 677.3454 | 1352.6762 | 1352.6572 | 14.1 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
KLENDYTSLNR + Deamidated (NQ) | |
| 560.7740 | 1119.5334 | 1119.5342 | -0.69 | 1 | 1 | 0.91 | 1Score > 21 indicates identityScore > 13 indicates homology |
NAENGQMTKK | |
| 571.7637 | 1141.5128 | 1141.5251 | -10.7 | 0 | 1 | 4.2 | 1Score > 19 indicates identity |
TASAPNSGNPPK + 2 Deamidated (NQ) | |
| 371.1809 | 740.3472 | 740.3453 | 2.64 | 0 | 1 | 2.4 | 1Score > 17 indicates identity |
HNNDLK + Deamidated (NQ) | |
| 1085.5380 | 2169.0614 | 2169.0841 | -10.4 | 1 | 1 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
SAEYSLKEIQIEELQDFK | |
| 963.1185 | 2886.3337 | 2886.3878 | -18.7 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
NITGISNSELLSEMNNDISMFGILLK + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 800.3809 | 799.3736 | 799.3864 | -16.0 | 0 | 1 | 2.1 | 1Score > 16 indicates identity |
YNYAIR + Deamidated (NQ) | |
| 950.4611 | 949.4538 | 949.4716 | -18.7 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
LSDGSSEKK | |
| 1083.9905 | 2165.9664 | 2165.9600 | 2.97 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
GQLDLINDGEGSLSNFADNGK + 3 Deamidated (NQ) | |
| 902.0750 | 4505.3386 | 4505.2846 | 12.0 | 1 | 1 | 1.9 | 1Score > 16 indicates identity |
TILDIVNIQNELSNHLTVQSQNINLMLNNQDDIELNIKK + 4 Deamidated (NQ) | |
| 1021.5449 | 1020.5376 | 1020.5240 | 13.3 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
ETALDFIGR | |
| 687.3440 | 1372.6734 | 1372.6697 | 2.75 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
LSLDSFFEMIR + Oxidation (M) | |
| 513.5782 | 1537.7128 | 1537.6871 | 16.7 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
YEKMFYNQAATR + Deamidated (NQ); Oxidation (M) | |
| 868.4635 | 1734.9124 | 1734.9021 | 5.96 | 0 | 1 | 0.97 | 1Score > 21 indicates identityScore > 13 indicates homology |
ILFQYWLFYNSLK + Deamidated (NQ) | |
| 950.4705 | 949.4632 | 949.4756 | -13.1 | 0 | 1 | 0.97 | 1Score > 22 indicates identityScore > 13 indicates homology |
NNVVINFK + 3 Deamidated (NQ) | |
| 952.4506 | 1902.8866 | 1902.9058 | -10.1 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
KNGSQEQELGDIVDEIK + 2 Deamidated (NQ) | |
| 1184.8998 | 3551.6776 | 3551.7429 | -18.4 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
IAYTFGWEGPALTVDTACSSSLVGIHLAMQALR + Deamidated (NQ); Oxidation (M) | |
| 781.9234 | 1561.8322 | 1561.8028 | 18.9 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
GILNYYKLATNYK + 2 Deamidated (NQ) | |
| 998.4747 | 1994.9348 | 1994.9619 | -13.6 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
GIVDIYSNDVMIIDNNGK + Oxidation (M) | |
| 668.7001 | 2003.0785 | 2003.0840 | -2.76 | 1 | 1 | 4.1 | 1Score > 19 indicates identity |
FQAERGLDVLVLLTSWR + Deamidated (NQ) | |
| 568.8420 | 1135.6694 | 1135.6601 | 8.22 | 1 | 1 | 1.1 | 1Score > 14 indicates identity |
KTQVYTGIVK | |
| 917.1353 | 2748.3841 | 2748.3316 | 19.1 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
NAAWLVFANKQDLPEAMSAAEITEK + 2 Deamidated (NQ) | |
| 339.6647 | 677.3148 | 677.3166 | -2.66 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
MSTPAR + Oxidation (M) | |
| 743.4055 | 742.3982 | 742.3974 | 1.17 | 0 | 1 | 2.9 | 1Score > 18 indicates identity |
QGGSAPVK | |
| 547.7656 | 1093.5166 | 1093.5186 | -1.77 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
SQVSQNRMK + Deamidated (NQ); Oxidation (M) | |
| 689.3560 | 2065.0462 | 2065.0102 | 17.4 | 1 | 1 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
AVYENNETGVIKNLELQK + 4 Deamidated (NQ) | |
| 802.0816 | 2403.2230 | 2403.2091 | 5.79 | 0 | 1 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
VNIALAELLTVSTDDTDMPLEK + Oxidation (M) | |
| 821.2094 | 4101.0106 | 4101.0214 | -2.62 | 0 | 0 | 4 | 1Score > 19 indicates identity |
IMLVFVIIDGITSNESILDMSQVNYIPDQYGNPQLK + 2 Deamidated (NQ); 2 Oxidation (M) | |
| 594.3049 | 2373.1905 | 2373.2151 | -10.4 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
FYRVVNMSFGGDTNLILAALR + Deamidated (NQ); Oxidation (M) | |
| 518.7766 | 1035.5386 | 1035.5284 | 9.91 | 0 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
LGHPCPLSR | |
| 631.3194 | 1260.6242 | 1260.6197 | 3.59 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
GKQIESEGGNLK + 2 Deamidated (NQ) | |
| 524.7632 | 1047.5118 | 1047.5026 | 8.86 | 0 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
GPFNWTVEV | |
| 628.3115 | 1254.6084 | 1254.6278 | -15.4 | 1 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
YMEQIKGTGTK | |
| 967.4886 | 966.4813 | 966.4844 | -3.22 | 1 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
KGIQMFDK + Deamidated (NQ) | |
| 581.6646 | 1741.9720 | 1741.9978 | -14.8 | 0 | 0 | 2.6 | 1Score > 17 indicates identity |
FAASIPSVVNVLDAVIK | |
| 911.4603 | 910.4530 | 910.4621 | -9.93 | 1 | 0 | 4.5 | 1Score > 20 indicates identity |
KHATPSDR | |
| 534.9495 | 1601.8267 | 1601.8382 | -7.17 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
STVPIIIRCCIDR | |
| 585.7833 | 1169.5520 | 1169.5313 | 17.8 | 0 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
ADPTNGPAENGK | |
| 810.4095 | 1618.8044 | 1618.7872 | 10.6 | 1 | 0 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
EQQQLGMLDDKVAK + Deamidated (NQ); Oxidation (M) | |
| 398.2102 | 794.4058 | 794.4174 | -14.6 | 0 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
VSTTYPK | |
| 777.3722 | 2329.0948 | 2329.1260 | -13.4 | 0 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
MSDNLLSLENPVVPSHYELR + Deamidated (NQ); Oxidation (M) | |
| 315.6646 | 629.3146 | 629.3133 | 2.18 | 0 | 0 | 1.6 | 1Score > 15 indicates identity |
TAQPGR + Deamidated (NQ) | |
| 781.9012 | 1561.7878 | 1561.7592 | 18.3 | 0 | 0 | 0.98 | 1Score > 23 indicates identityScore > 13 indicates homology |
IICPSVESISNGMR | |
| 775.4034 | 2323.1884 | 2323.1478 | 17.5 | 0 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
TIMNIDATTEGENLHVLSPPR + Oxidation (M) | |
| 483.7363 | 965.4580 | 965.4753 | -17.8 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
IATRGAFAC | |
| 600.5532 | 2398.1837 | 2398.1917 | -3.34 | 1 | 0 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
QPGHTDWAVIQLGRESSFIEK + Deamidated (NQ) | |
| 550.2736 | 1098.5326 | 1098.5458 | -12.0 | 0 | 0 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
TYYLQGAQR | |
| 953.4348 | 952.4275 | 952.4362 | -9.14 | 1 | 0 | 3.8 | 1Score > 19 indicates identity |
DAYRGQSR + Deamidated (NQ) | |
| 1183.5724 | 2365.1302 | 2365.1471 | -7.11 | 1 | 0 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
SMNLLQELSPRLFEAANASEK + 2 Deamidated (NQ); Oxidation (M) | |
| 716.3846 | 1430.7546 | 1430.7518 | 2.02 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
IGAWASRQSDVIK + Deamidated (NQ) | |
| 749.3730 | 1496.7314 | 1496.7147 | 11.2 | 0 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
LDSEFQPLSSAFR + Deamidated (NQ) | |
| 752.8723 | 1503.7300 | 1503.7425 | -8.31 | 0 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
SPTGIVLMNMGGPSK + Oxidation (M) | |
| 349.1982 | 696.3818 | 696.3919 | -14.4 | 0 | 0 | 1.6 | 1Score > 15 indicates identity |
SVNHLK | |
| 579.7607 | 1157.5068 | 1157.5274 | -17.8 | 0 | 0 | 3.7 | 1Score > 18 indicates identity |
GNYMLVSQTK + 2 Deamidated (NQ); Oxidation (M) | |
| 992.8385 | 2975.4937 | 2975.5202 | -8.90 | 1 | 0 | 0.96 | 1Score > 21 indicates identityScore > 13 indicates homology |
KNTTYVATLIYEFIILNDASMTPDVK + Oxidation (M) | |
| 1124.8068 | 5618.9976 | 5618.9967 | 0.16 | 1 | 0 | 0.92 | 1Score > 13 indicates identity |
AMVLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYK + Deamidated (NQ) | |
| 400.7171 | 799.4196 | 799.4188 | 1.05 | 0 | 0 | 3.6 | 1Score > 18 indicates identity |
QKPDQGK | |
| 695.3385 | 1388.6624 | 1388.6831 | -14.8 | 0 | 0 | 0.96 | 1Score > 21 indicates identityScore > 13 indicates homology |
NGMVVGLGAGQQSR + Oxidation (M) | |
| 521.6019 | 1561.7839 | 1561.7997 | -10.1 | 0 | 0 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
VLQTMSFLMNHLI + Oxidation (M) | |
| 794.9087 | 1587.8028 | 1587.8256 | -14.3 | 1 | 0 | 1 | 1Score > 24 indicates identityScore > 13 indicates homology |
AAQNPLADIQVYKR + 2 Deamidated (NQ) | |
| 622.6384 | 1864.8934 | 1864.8625 | 16.6 | 1 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
EEAGAANEQMPYNKAVK + Oxidation (M) | |
| 940.6689 | 4698.3081 | 4698.2518 | 12.0 | 1 | 0 | 3.8 | 1Score > 19 indicates identity |
FQKPYNPLAMDSYALGIMLITMINNIIPFIDSCNTDARFR + 3 Deamidated (NQ); 2 Oxidation (M) | |
| 1152.5498 | 1151.5425 | 1151.5346 | 6.86 | 0 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
ITDDNEIGFK + Deamidated (NQ) | |
| 847.3828 | 1692.7510 | 1692.7559 | -2.89 | 1 | 0 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
ETSNKQTACPICQR + Deamidated (NQ) | |
| 943.8542 | 2828.5408 | 2828.5840 | -15.3 | 1 | 0 | 1.7 | 1Score > 15 indicates identity |
TLIFSRFSFNLVLLAVVDYQIITR + Deamidated (NQ) | |
| 732.3587 | 1462.7028 | 1462.6973 | 3.77 | 0 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
SLNTNSPISELCK + Deamidated (NQ) | |
| 610.2943 | 1218.5740 | 1218.5564 | 14.5 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
GKSANFCGNHK | |
| 469.9762 | 1875.8757 | 1875.9115 | -19.1 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
REPFFHGTSNTDQLVK + Deamidated (NQ) | |
| 788.3784 | 1574.7422 | 1574.7576 | -9.77 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
SGVQTAYIDYSSKR + Deamidated (NQ) | |
| 922.1370 | 2763.3892 | 2763.4402 | -18.5 | 1 | 0 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
SLNELSLSDILIAADVEGGLHAVDRR + Deamidated (NQ) | |
| 672.8279 | 1343.6412 | 1343.6510 | -7.25 | 0 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
DGEWLYHISPK | |
| 789.9206 | 1577.8266 | 1577.8487 | -14.0 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
LKFASNLMVINPSK + Deamidated (NQ); Oxidation (M) | |
| 868.4271 | 1734.8396 | 1734.8617 | -12.7 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
ERNYIVAFIFGNYK + 2 Deamidated (NQ) | |
| 584.6035 | 1750.7887 | 1750.8009 | -7.00 | 1 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
QPDDIINNDEPSHKK + 2 Deamidated (NQ) | |
| 1039.5046 | 2076.9946 | 2077.0361 | -20.0 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
SLDELCGVQLTSTLRQQK + 2 Deamidated (NQ) | |
| 739.3282 | 2214.9628 | 2214.9742 | -5.14 | 1 | 0 | 3.8 | 1Score > 18 indicates identity |
VQLCTLMNIKSGGCSEDCK + Oxidation (M) | |
| 1079.8875 | 3236.6407 | 3236.6324 | 2.57 | 1 | 0 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
QSASVTLWQVIGNSVMAFILGSMFYKVMK + 2 Deamidated (NQ) | |
| 836.9415 | 1671.8684 | 1671.8679 | 0.32 | 0 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
SIPPVTSSIQAQQSTK + Deamidated (NQ) | |
| 636.3044 | 1270.5942 | 1270.5789 | 12.1 | 0 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
NGQASAPRPNQK + 4 Deamidated (NQ) | |
| 976.9856 | 1951.9566 | 1951.9350 | 11.1 | 0 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
EEAAPKPPSSAVFSMFGGK + Oxidation (M) | |
| 1029.4906 | 2056.9666 | 2056.9371 | 14.4 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
SMTPFSAGNTSSQNKLENK + Deamidated (NQ); Oxidation (M) | |
| 521.5998 | 1561.7776 | 1561.7997 | -14.1 | 0 | 0 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
VLQTMSFLMNHLI + Oxidation (M) | |
| 1064.5415 | 1063.5342 | 1063.5410 | -6.40 | 1 | 0 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
RTAQFEANK | |
| 603.7983 | 1205.5820 | 1205.5962 | -11.7 | 0 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
IGIETNMLGDK + Oxidation (M) | |
| 300.0932 | 299.0859 | ||||||||
| 300.2087 | 299.2014 | ||||||||
| 301.1169 | 300.1096 | ||||||||
| 301.1435 | 300.1362 | ||||||||
| 301.1435 | 300.1362 | ||||||||
| 301.1435 | 300.1362 | ||||||||
| 301.1436 | 300.1363 | ||||||||
| 301.1438 | 300.1365 | ||||||||
Not what you expected? Try
the select summary.