MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 3
MS data file : PRT1245_Other_P1_B11.mgf
Database : S-cerevisiae-S288C 20191206 (6,886 sequences; 3,133,934 residues)
Timestamp : 24 Jun 2025 at 21:21:58 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,722

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 401–500 (out of 4645)

Page: Previous 1 2 3 4 5 6 7 8 9 10 … 47 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4508 792.6718 3166.6581 3166.6108 14.9 1 2 2.7 +1Score > 19 indicates identity ILATQGAIGTVFVGVMEPDTFVKNNTSLNK + 3 Deamidated (NQ)
4546 825.8882 3299.5237 3299.4928 9.37 1 2 0.82 +1Score > 22 indicates identity
Score > 14 indicates homology		 EYSNENDASGEFSAFNTPMENIPALKGIPR + 2 Deamidated (NQ)
992 608.3424 607.3351 607.3442 -14.9 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 HNLPK
3062 834.3936 1666.7726 1666.7686 2.44 0 2 0.7 +1Score > 22 indicates identity
Score > 13 indicates homology		 GSNVISNDVYDQINK + 2 Deamidated (NQ)
2006 1078.5225 1077.5152 1077.4985 15.5 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 NRISMNGNR + Deamidated (NQ); Oxidation (M)
1188 778.3763 777.3690 777.3691 -0.051 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 KLDNCK + Deamidated (NQ)
2332 579.3524 1156.6902 1156.6928 -2.19 1 2 2.2 +1Score > 18 indicates identity ISTRIIEGLR
3556 511.0349 2040.1105 2040.1077 1.35 1 2 2.5 +1Score > 18 indicates identity ALQHQIASKALLMGFPGLK + 2 Deamidated (NQ); Oxidation (M)
4207 856.4205 2566.2397 2566.2301 3.74 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 EANMTINIYDFYIAFRETLPK + 2 Deamidated (NQ); Oxidation (M)
4286 922.4691 2764.3855 2764.3483 13.4 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 IKSFGDSVPYIEEALQVYSTEFDK
981 584.3413 583.3340 583.3442 -17.4 0 2 0.66 +1Score > 13 indicates identity VAAPAR
2629 677.3426 1352.6706 1352.6460 18.3 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 GKESLQDVYDAK + Deamidated (NQ)
3078 560.9275 1679.7607 1679.7937 -19.6 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 FQGCNNLIKNISNR + 3 Deamidated (NQ)
961 554.3058 553.2985 553.3085 -18.0 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 KHGGR
3222 897.9598 1793.9050 1793.8869 10.1 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 VVNMEFPIDEATGKTK + Oxidation (M)
2479 601.7925 1201.5704 1201.5761 -4.70 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 ANTPSSMHKTK + Deamidated (NQ)
4321 935.1279 2802.3619 2802.3091 18.8 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 QPSVNLFSTLMNGNMEKNGLALNFK + 4 Deamidated (NQ); 2 Oxidation (M)
3534 674.6511 2020.9315 2020.9710 -19.6 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 RPEYKSQDVCGPIPTMK + Oxidation (M)
2121 1106.5355 1105.5282 1105.5147 12.2 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 MVEPDMQKK + Deamidated (NQ)
2854 765.9080 1529.8014 1529.8300 -18.7 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 KISQLVQENVTLR + 3 Deamidated (NQ)
1078 342.1961 682.3776 682.3762 2.11 1 2 1.9 +1Score > 17 indicates identity GPKEPR
2806 750.9219 1499.8292 1499.8446 -10.2 1 2 3.3 +1Score > 19 indicates identity ATLKDQLIQNLLK + 3 Deamidated (NQ)
1930 528.7701 1055.5256 1055.5247 0.88 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 EKGLTHEDK
3399 968.4683 1934.9220 1934.9255 -1.79 0 2 0.75 +1Score > 23 indicates identity
Score > 13 indicates homology		 QLVGETISDANMNTLAGGK + Deamidated (NQ); Oxidation (M)
1180 386.2254 770.4362 770.4399 -4.69 1 2 2.5 +1Score > 18 indicates identity LQPRTR + Deamidated (NQ)
2011 540.2618 1078.5090 1078.4964 11.7 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 QLSMKNNDK + 2 Deamidated (NQ)
4653 1053.7762 4211.0757 4211.0739 0.42 0 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 DYEKPIFNPPDFTSLEVLTFTGSGIPAGINIPNYDDVR
2680 709.3408 1416.6670 1416.6707 -2.60 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 GPLTNYKSCYSK
4352 952.4876 2854.4410 2854.4488 -2.73 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 EYVSLVGQVLLDGSSLSNEEILQFSK + Deamidated (NQ)
3632 692.0348 2073.0826 2073.0854 -1.37 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 AIAISNDFISNRPIKQER + 2 Deamidated (NQ)
3938 751.0364 2250.0874 2250.0573 13.4 1 2 0.74 +1Score > 22 indicates identity
Score > 13 indicates homology		 VTTNSQGSSLEPNKLNMAVEK + 4 Deamidated (NQ)
3992 1151.5698 2301.1250 2301.1675 -18.4 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 LSMESPHVNVFSILTDLDIR + Oxidation (M)
2631 677.3434 1352.6722 1352.6460 19.4 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 GKESLQDVYDAK + Deamidated (NQ)
1895 524.7831 1047.5516 1047.5461 5.26 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 ARGVEVDFR
2855 765.9091 1529.8036 1529.8300 -17.3 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 KISQLVQENVTLR + 3 Deamidated (NQ)
2720 723.8728 1445.7310 1445.7150 11.1 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 LANEKPEDVFER
2870 769.8645 1537.7144 1537.7233 -5.75 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 RPDNQNPEGENLR
2890 777.9510 1553.8874 1553.9037 -10.5 1 2 1.9 +1Score > 17 indicates identity LVLLTPCLPCIKK
3270 917.4817 1832.9488 1832.9632 -7.83 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 SGQIQPHLDQLNLVLR + 3 Deamidated (NQ)
1173 767.3686 766.3613 766.3497 15.1 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 AGNFTQK + 2 Deamidated (NQ)
2116 553.2919 1104.5692 1104.5788 -8.66 1 1 0.77 +1Score > 23 indicates identity
Score > 13 indicates homology		 QRSFNANLR
3475 993.4901 1984.9656 1984.9313 17.3 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 DVQYDAACADLRISFNK
1631 968.4694 967.4621 967.4545 7.85 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 FMEQKNR + Oxidation (M)
1584 951.4241 950.4168 950.4127 4.32 0 1 2.8 +1Score > 18 indicates identity GINGMSNNK + Deamidated (NQ); Oxidation (M)
2717 723.8719 1445.7292 1445.7085 14.3 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 SHGAVLPSYCSLR
3106 852.4250 1702.8354 1702.8625 -15.9 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 QKTISLDDLNDLAQK + 2 Deamidated (NQ)
2509 618.7777 1235.5408 1235.5418 -0.80 0 1 3.1 +1Score > 19 indicates identity EQDQYQGGPSK
2526 629.3215 1256.6284 1256.6071 17.0 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 NQMAHLVDLAK + 2 Deamidated (NQ); Oxidation (M)
1797 511.2739 1020.5332 1020.5200 13.0 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 LTSGSGSERK
2480 602.8031 1203.5916 1203.6104 -15.6 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 GPLKGCLNMSK
1577 949.5112 948.5039 948.5029 1.13 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 GIAYQLQR + Deamidated (NQ)
3053 552.9188 1655.7346 1655.7283 3.77 1 1 3.6 +1Score > 19 indicates identity ERDFIQQMMDPSK + 2 Oxidation (M)
3072 419.4587 1673.8057 1673.8368 -18.6 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 DCPLKDTPMLEVLK + Oxidation (M)
3012 407.9471 1627.7593 1627.7399 11.9 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 TQGYTVADCTAEAIK + Deamidated (NQ)
1226 800.3798 799.3725 799.3864 -17.4 0 1 1.9 +1Score > 17 indicates identity YNYAIR + Deamidated (NQ)
2828 757.9135 1513.8124 1513.8239 -7.56 0 1 0.9 +1Score > 21 indicates identity
Score > 13 indicates homology		 QLLTDDNLLNIIK + 2 Deamidated (NQ)
2848 510.2254 1527.6544 1527.6841 -19.5 0 1 3.3 +1Score > 19 indicates identity AQIYDDQLQNYR + 2 Deamidated (NQ)
2202 563.2828 1124.5510 1124.5350 14.3 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 SEGYVTDGLGK
2746 730.8757 1459.7368 1459.7154 14.7 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 INGLNSNNSIIGNK + 3 Deamidated (NQ)
1951 1063.5137 1062.5064 1062.4989 7.12 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 GMQRSSQNR
3572 683.3625 2047.0657 2047.0296 17.6 1 1 0.98 +1Score > 21 indicates identity
Score > 14 indicates homology		 TQSDLQKFMTQLDHLIK + 2 Deamidated (NQ)
3061 556.2581 1665.7525 1665.7201 19.5 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 MDWINPQMMKDPK + Deamidated (NQ); 2 Oxidation (M)
1193 781.3479 780.3406 780.3402 0.51 0 1 2.6 +1Score > 18 indicates identity QESFDR
1968 1066.5143 1065.5070 1065.5203 -12.5 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 SAFSQKQNR + Deamidated (NQ)
2028 542.7596 1083.5046 1083.5019 2.57 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 RLQGNGMYK + 2 Deamidated (NQ); Oxidation (M)
2723 723.8743 1445.7340 1445.7085 17.7 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 SHGAVLPSYCSLR
1001 613.2951 612.2878 612.2980 -16.6 0 1 1.5 +1Score > 16 indicates identity NHSGAK
2113 553.2740 1104.5334 1104.5485 -13.6 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 AMALDAQLQK + Deamidated (NQ); Oxidation (M)
2615 669.3494 1336.6842 1336.6986 -10.8 0 1 0.88 +1Score > 23 indicates identity
Score > 13 indicates homology		 NSLSISNLAYVR + Deamidated (NQ)
3065 835.4083 1668.8020 1668.8107 -5.20 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 YVDLGNGLGLNTYNR + Deamidated (NQ)
2951 794.9076 1587.8006 1587.8256 -15.7 1 1 1 +1Score > 24 indicates identity
Score > 14 indicates homology		 AAQNPLADIQVYKR + 2 Deamidated (NQ)
2897 781.8960 1561.7774 1561.7592 11.7 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 IICPSVESISNGMR
3797 712.6884 2135.0434 2135.0690 -12.0 1 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 VANGLPPYKVICMGIANMR + 2 Oxidation (M)
3453 656.9968 1967.9686 1967.9550 6.90 1 1 0.85 +1Score > 22 indicates identity
Score > 13 indicates homology		 LTNEDPPGLMYLKAFDK + Deamidated (NQ); Oxidation (M)
3755 1058.5365 2115.0584 2115.0848 -12.5 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 GDQFASLGVSSLLVSHLEQK + Deamidated (NQ)
2114 553.2894 1104.5642 1104.5604 3.52 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 NAPLWNVYK + Deamidated (NQ)
3466 991.4891 1980.9636 1980.9527 5.52 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 IQYNLDTIDAEKNISNK + 3 Deamidated (NQ)
4599 1183.5752 3547.7038 3547.7406 -10.4 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 TCQPSWIHSQHELNPQDSIVQGIFQLATLAK + 2 Deamidated (NQ)
2488 606.7891 1211.5636 1211.5571 5.42 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 EDDIPANWPR
4271 912.4656 2734.3750 2734.3926 -6.44 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 HIQHTIYDDLTNRILNNDVLPTK + 2 Deamidated (NQ)
4314 932.1285 2793.3637 2793.3709 -2.58 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 KDDDDVIAPLPNADGDIPAISDGVFPK
2520 625.3345 1248.6544 1248.6350 15.6 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 ELNLGKDEFGK
2170 1119.6128 1118.6055 1118.6118 -5.58 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 IMVIGGKNSGK + Oxidation (M)
3774 708.6927 2123.0563 2123.0351 9.98 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 LNRQGTMVATCSVQGTLIR + 3 Deamidated (NQ); Oxidation (M)
4212 646.6123 2582.4201 2582.4214 -0.49 1 1 1.6 +1Score > 15 indicates identity VLRNAITGATGIASNLLLCDELLR
2117 553.2928 1104.5710 1104.5788 -7.03 1 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 QRSFNANLR
1342 860.4210 859.4137 859.4188 -5.90 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 WADEALR
2633 680.3688 1358.7230 1358.7154 5.66 1 1 0.87 +1Score > 22 indicates identity
Score > 13 indicates homology		 IETLQLESDRR
2220 1132.5422 1131.5349 1131.5520 -15.1 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 EAEERTELR
2660 695.3444 1388.6742 1388.6758 -1.13 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 ISRNTSLYCFK + Deamidated (NQ)
4118 808.1086 2421.3040 2421.2904 5.62 1 1 1.9 +1Score > 16 indicates identity FNTDLGQHILKNPLVAQGIVDK + 2 Deamidated (NQ)
2875 773.3738 1544.7330 1544.7181 9.68 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 KDGFSQFMPSATTK + Deamidated (NQ)
2907 782.4099 1562.8052 1562.7940 7.19 0 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 NDTQLQLIVNYNK + Deamidated (NQ)
4191 843.0632 2526.1678 2526.1413 10.5 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 FMYDTFDDHYQATIGIDFLSK
3616 689.3213 2064.9421 2064.9083 16.4 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 RSNSDLQAQTASQSQSPEK + 4 Deamidated (NQ)
2282 573.8191 1145.6236 1145.6332 -8.35 0 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 GIIPLDVYEK
3176 875.9727 1749.9308 1749.9447 -7.94 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 MTGFVNIVNSTLSVLR
4699 1118.7333 5588.6301 5588.5633 12.0 0 1 2 +1Score > 16 indicates identity EPSNMFMGSPVHYSTSQSPPHISIPQQQQSSGPYLISSLPPQQPTVNMMR + 2 Deamidated (NQ); 4 Oxidation (M)
2525 419.8834 1256.6284 1256.6336 -4.13 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 KANQPIVHYGM
3642 1038.0475 2074.0804 2074.0557 11.9 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 SYTYNNFPMVLKNSGVIK
Page: Previous 1 2 3 4 5 6 7 8 9 10 … 47 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/