MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 3 |
| MS data file | : | PRT1245_Other_P1_B11.mgf |
| Database | : | S-cerevisiae-S288C 20191206 (6,886 sequences; 3,133,934 residues) |
| Timestamp | : | 24 Jun 2025 at 21:21:58 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,722 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 1286 |
418.2380 | 834.4614 | 834.4599 | 1.82 | 1 | 5 | 0.81 | 1Score > 21 indicates identity Score > 17 indicates homology |
KPDGKYK |
| 1196 |
781.4257 | 780.4184 | 780.4170 | 1.80 | 0 | 5 | 0.48 | 1Score > 21 indicates identity Score > 15 indicates homology |
FVYPQK |
| 2379 |
584.3120 | 1166.6094 | 1166.6295 | -17.2 | 0 | 5 | 1 | 1Score > 22 indicates identity Score > 18 indicates homology |
NTSPDPALKPK |
| 983 |
586.3210 | 585.3137 | 585.3235 | -16.6 | 0 | 5 | 1.2 | 1Score > 19 indicates identity |
AVSPGR |
| 2765 |
737.8652 | 1473.7158 | 1473.7385 | -15.3 | 1 | 5 | 0.94 | 1Score > 22 indicates identity Score > 17 indicates homology |
IGIPQEMIDDAKK + Deamidated (NQ); Oxidation (M) |
| 3974 |
764.0583 | 2289.1531 | 2289.1207 | 14.1 | 1 | 5 | 1 | 1Score > 22 indicates identity Score > 18 indicates homology |
MMNELLQKLPTCYYQTLK + Oxidation (M) |
| 3997 |
1152.5724 | 2303.1302 | 2303.1467 | -7.16 | 1 | 5 | 0.88 | 1Score > 22 indicates identity Score > 17 indicates homology |
DVGEEKQTLHQIFADSMVIK + Oxidation (M) |
| 4120 |
809.3668 | 2425.0786 | 2425.1049 | -10.9 | 1 | 5 | 1.4 | 1Score > 19 indicates identity |
LMENHACNGLTSCKEQLHQR |
| 1715 |
997.4593 | 996.4520 | 996.4625 | -10.5 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
DNPPNGEVR |
| 1134 |
370.7014 | 739.3882 | 739.3752 | 17.7 | 0 | 5 | 1.2 | 1Score > 18 indicates identity |
QYSTLK + Deamidated (NQ) |
| 2721 |
723.8730 | 1445.7314 | 1445.7085 | 15.9 | 0 | 5 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
SHGAVLPSYCSLR |
| 2501 |
610.8281 | 1219.6416 | 1219.6448 | -2.60 | 0 | 5 | 0.35 | 1Score > 23 indicates identity Score > 13 indicates homology |
AVGNIVNEIYK + Deamidated (NQ) |
| 2643 |
685.3209 | 1368.6272 | 1368.6265 | 0.56 | 1 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
SMVKVMLNDNGK + 2 Deamidated (NQ); 2 Oxidation (M) |
| 1264 |
411.7279 | 821.4412 | 821.4317 | 11.7 | 0 | 5 | 0.41 | 1Score > 21 indicates identity Score > 13 indicates homology |
MSSAIVAK + Oxidation (M) |
| 1504 |
928.4119 | 927.4046 | 927.4158 | -12.1 | 1 | 5 | 0.94 | 1Score > 17 indicates identity |
RTQNDHR + 2 Deamidated (NQ) |
| 2914 |
785.8914 | 1569.7682 | 1569.7569 | 7.21 | 1 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
DIVASFMSRAGSASR + Oxidation (M) |
| 1578 |
475.2596 | 948.5046 | 948.5029 | 1.88 | 1 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
GPRTLYDK |
| 2194 |
562.8291 | 1123.6436 | 1123.6601 | -14.7 | 0 | 5 | 0.81 | 1Score > 16 indicates identity |
VVVATSLNPPK |
| 3469 |
991.5035 | 1980.9924 | 1980.9792 | 6.67 | 1 | 5 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
NLDTFLNQLRDFLNEK + 2 Deamidated (NQ) |
| 1064 |
678.3222 | 677.3149 | 677.3245 | -14.2 | 0 | 5 | 0.54 | 1Score > 22 indicates identity Score > 14 indicates homology |
NANFGR |
| 1381 |
438.7389 | 875.4632 | 875.4726 | -10.6 | 0 | 5 | 1 | 1Score > 23 indicates identity Score > 17 indicates homology |
HNQKPPR |
| 3442 |
655.6337 | 1963.8793 | 1963.9044 | -12.8 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
AANLGGVAVSGLEMAQNSQK + 4 Deamidated (NQ); Oxidation (M) |
| 1506 |
928.4744 | 927.4671 | 927.4774 | -11.1 | 0 | 5 | 0.45 | 1Score > 20 indicates identity Score > 14 indicates homology |
QSHAVATSK |
| 2891 |
519.2569 | 1554.7489 | 1554.7679 | -12.2 | 0 | 5 | 0.57 | 1Score > 22 indicates identity Score > 15 indicates homology |
WTVTGTFLTTGDTR |
| 1190 |
779.4166 | 778.4093 | 778.4086 | 0.97 | 1 | 5 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
RNSFVR + Deamidated (NQ) |
| 3737 |
704.0237 | 2109.0493 | 2109.0187 | 14.5 | 1 | 5 | 1 | 1Score > 23 indicates identity Score > 17 indicates homology |
MKDYSNIVEPTLEDPTLK + Deamidated (NQ); Oxidation (M) |
| 1295 |
420.7332 | 839.4518 | 839.4501 | 2.08 | 0 | 5 | 1.3 | 1Score > 18 indicates identity |
NATPVNPK |
| 3710 |
701.3641 | 2101.0705 | 2101.0731 | -1.27 | 0 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
WLLELAVETFEDANINPK |
| 3855 |
1085.5365 | 2169.0584 | 2169.0372 | 9.82 | 1 | 5 | 1 | 1Score > 23 indicates identity Score > 17 indicates homology |
LTYDMLSQDKIINNTNNR + Deamidated (NQ); Oxidation (M) |
| 1120 |
729.3410 | 728.3337 | 728.3381 | -6.04 | 0 | 5 | 0.37 | 1Score > 13 indicates identity |
TSLDFF |
| 2887 |
776.8482 | 1551.6818 | 1551.6657 | 10.4 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
NTNIGGMIAECAER + Deamidated (NQ); Oxidation (M) |
| 2960 |
531.2486 | 1590.7240 | 1590.7460 | -13.9 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
VATMQVWDTAGQER |
| 3467 |
991.4904 | 1980.9662 | 1980.9792 | -6.55 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
NLDTFLNQLRDFLNEK + 2 Deamidated (NQ) |
| 1575 |
948.4569 | 947.4496 | 947.4308 | 19.9 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
NNESNNKK + Deamidated (NQ) |
| 2673 |
703.3413 | 1404.6680 | 1404.6885 | -14.5 | 0 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
NPGSINIYEIER + Deamidated (NQ) |
| 2551 |
639.3306 | 1276.6466 | 1276.6636 | -13.3 | 1 | 4 | 1 | 1Score > 23 indicates identity Score > 17 indicates homology |
SPTNNNPRIHK |
| 1183 |
772.4235 | 771.4162 | 771.4239 | -9.94 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
LGGQEIR |
| 4264 |
904.0894 | 2709.2464 | 2709.1945 | 19.2 | 1 | 4 | 0.78 | 1Score > 21 indicates identity Score > 16 indicates homology |
SGFHNVGNINMMAQQQMQQNRIK + 4 Deamidated (NQ); 2 Oxidation (M) |
| 4117 |
807.7191 | 2420.1355 | 2420.1536 | -7.49 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
FSYSPPKEGNYEIVFDTVSNK |
| 1246 |
406.2206 | 810.4266 | 810.4348 | -10.0 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
VSPNAAPR |
| 1336 |
858.4187 | 857.4114 | 857.4171 | -6.58 | 0 | 4 | 1.4 | 1Score > 18 indicates identity |
YLSNIFT + Deamidated (NQ) |
| 3207 |
889.4391 | 1776.8636 | 1776.8564 | 4.10 | 1 | 4 | 0.75 | 1Score > 22 indicates identity Score > 16 indicates homology |
EQVQQVVMEGKTQEK + Deamidated (NQ); Oxidation (M) |
| 2893 |
778.9205 | 1555.8264 | 1555.8205 | 3.80 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
QKNILPSAVQSNEK + Deamidated (NQ) |
| 2974 |
801.9199 | 1601.8252 | 1601.8382 | -8.06 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
STVPIIIRCCIDR |
| 2146 |
557.2819 | 1112.5492 | 1112.5713 | -19.9 | 0 | 4 | 0.4 | 1Score > 20 indicates identity Score > 13 indicates homology |
DLEEGPTKPK |
| 1751 |
1006.4833 | 1005.4760 | 1005.4740 | 2.01 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
FANRNNNR + Deamidated (NQ) |
| 2930 |
789.8994 | 1577.7842 | 1577.7533 | 19.6 | 1 | 4 | 1 | 1Score > 23 indicates identity Score > 17 indicates homology |
ERDGSTEETLNSLK |
| 3967 |
1141.5909 | 2281.1672 | 2281.1273 | 17.5 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
NLAYNIGIHVEGACPQIQQR + Deamidated (NQ) |
| 2353 |
581.7938 | 1161.5730 | 1161.5513 | 18.7 | 0 | 4 | 1 | 1Score > 23 indicates identity Score > 17 indicates homology |
GLLGDSENETK |
| 2739 |
728.8867 | 1455.7588 | 1455.7681 | -6.38 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
KTTTSPINIPGGNR + Deamidated (NQ) |
| 1962 |
533.2750 | 1064.5354 | 1064.5502 | -13.8 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
KNEIIEYR + Deamidated (NQ) |
| 2483 |
604.3085 | 1206.6024 | 1206.6026 | -0.15 | 1 | 4 | 1 | 1Score > 23 indicates identity Score > 17 indicates homology |
ILSMRNSENK + Oxidation (M) |
| 4442 |
753.9074 | 3011.6005 | 3011.6233 | -7.56 | 1 | 4 | 1.2 | 1Score > 17 indicates identity |
IHALHTVISHHYSQKDLIVIFPSDLK + Deamidated (NQ) |
| 3052 |
828.4097 | 1654.8048 | 1654.7910 | 8.34 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
KSQQHQTQGNQVLR + 4 Deamidated (NQ) |
| 1170 |
762.3463 | 761.3390 | 761.3378 | 1.65 | 0 | 4 | 1.7 | 1Score > 19 indicates identity |
ENSGPMK |
| 2610 |
667.8417 | 1333.6688 | 1333.6547 | 10.6 | 0 | 4 | 0.5 | 1Score > 22 indicates identity Score > 14 indicates homology |
MALGNEINITNK + Deamidated (NQ); Oxidation (M) |
| 4414 |
993.1015 | 2976.2827 | 2976.2978 | -5.08 | 1 | 4 | 1.3 | 1Score > 18 indicates identity |
GSMSVFQSCHTGLAFNQIQGSSSSQRR + 4 Deamidated (NQ); Oxidation (M) |
| 1639 |
485.7473 | 969.4800 | 969.4767 | 3.42 | 1 | 4 | 1.9 | 1Score > 19 indicates identity |
KDTTGSSFK |
| 4600 |
888.4207 | 3549.6537 | 3549.7144 | -17.1 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
GVQSPPKPPPSNEISGTIENDVESIKQAADNMAK + 2 Deamidated (NQ) |
| 1545 |
470.7406 | 939.4666 | 939.4709 | -4.48 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
VERPMHR + Oxidation (M) |
| 1716 |
499.2333 | 996.4520 | 996.4400 | 12.1 | 0 | 4 | 0.5 | 1Score > 20 indicates identity Score > 13 indicates homology |
ADSFINNSK + 2 Deamidated (NQ) |
| 2711 |
723.3762 | 1444.7378 | 1444.7596 | -15.0 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
SIVEPSGALSVAGMK |
| 2362 |
582.2960 | 1162.5774 | 1162.5982 | -17.9 | 0 | 4 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
LQTNQIFNGK + Deamidated (NQ) |
| 1294 |
840.4577 | 839.4504 | 839.4501 | 0.38 | 0 | 4 | 1.5 | 1Score > 18 indicates identity |
NATPVNPK |
| 3319 |
621.3299 | 1860.9679 | 1860.9615 | 3.43 | 1 | 4 | 0.81 | 1Score > 21 indicates identity Score > 15 indicates homology |
IDSNIISSPMVSKVEAR + Oxidation (M) |
| 3262 |
912.4165 | 1822.8184 | 1822.8155 | 1.60 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
NNFKIIDSHSMNNSGK + 2 Deamidated (NQ); Oxidation (M) |
| 4625 |
927.1975 | 3704.7609 | 3704.7662 | -1.42 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
MAHNQPAVTIDLGMVQSIGYVAETDSAVAERLQR + 3 Deamidated (NQ); 2 Oxidation (M) |
| 2015 |
540.7523 | 1079.4900 | 1079.4917 | -1.54 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
KNDDGSMVAK + Oxidation (M) |
| 1431 |
899.4955 | 898.4882 | 898.4760 | 13.6 | 0 | 4 | 1.5 | 1Score > 18 indicates identity |
KPVTPNDK + Deamidated (NQ) |
| 2418 |
589.3042 | 1176.5938 | 1176.5887 | 4.35 | 1 | 4 | 0.69 | 1Score > 24 indicates identity Score > 15 indicates homology |
QAKQLGFDDR |
| 2973 |
801.9177 | 1601.8208 | 1601.8382 | -10.8 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
STVPIIIRCCIDR |
| 2846 |
764.3556 | 1526.6966 | 1526.7221 | -16.7 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
GNSMLFTMNRDIK + Deamidated (NQ) |
| 4093 |
797.4386 | 2389.2940 | 2389.3104 | -6.87 | 0 | 4 | 1.3 | 1Score > 18 indicates identity |
LQVHLLENNNDLDLTIGLLLK + 2 Deamidated (NQ) |
| 1181 |
386.2256 | 770.4366 | 770.4399 | -4.20 | 0 | 4 | 1.5 | 1Score > 18 indicates identity |
GAGGIGALR |
| 3358 |
631.9680 | 1892.8822 | 1892.8682 | 7.39 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
AMKEMQPQPGLVDIMR + 2 Deamidated (NQ); 3 Oxidation (M) |
| 4668 |
1138.1057 | 4548.3937 | 4548.3726 | 4.63 | 1 | 4 | 0.61 | 1Score > 14 indicates identity |
GNVCLNILREDWSPALDLQSIITGLLFLFLEPNPNDPLNK |
| 3954 |
756.7098 | 2267.1076 | 2267.0740 | 14.8 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
VAVQQTQMQAGVDKLDSFER + 2 Deamidated (NQ); Oxidation (M) |
| 3468 |
991.4933 | 1980.9720 | 1980.9792 | -3.63 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
NLDTFLNQLRDFLNEK + 2 Deamidated (NQ) |
| 2344 |
580.7849 | 1159.5552 | 1159.5770 | -18.7 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
MVPTMFPPPK + Oxidation (M) |
| 2668 |
700.3984 | 1398.7822 | 1398.7653 | 12.1 | 1 | 4 | 1.9 | 1Score > 19 indicates identity |
QPNLKCIVLTGR + Deamidated (NQ) |
| 1535 |
469.7158 | 937.4170 | 937.4327 | -16.7 | 1 | 4 | 2.2 | 1Score > 20 indicates identity |
GEMKSGWK + Oxidation (M) |
| 1762 |
1008.4815 | 1007.4742 | 1007.4672 | 6.99 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
AVAEAYNNR + Deamidated (NQ) |
| 1271 |
414.2175 | 826.4204 | 826.4185 | 2.39 | 0 | 4 | 2.1 | 1Score > 19 indicates identity |
DPPSNGLK |
| 3018 |
816.9001 | 1631.7856 | 1631.7712 | 8.86 | 1 | 4 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
LGQQNNLPKLDMNK + 4 Deamidated (NQ); Oxidation (M) |
| 1440 |
451.7343 | 901.4540 | 901.4393 | 16.4 | 0 | 4 | 0.81 | 1Score > 22 indicates identity Score > 15 indicates homology |
SNVEVQPK + 2 Deamidated (NQ) |
| 4616 |
916.4536 | 3661.7853 | 3661.8363 | -13.9 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
SISVVSLFDDSVNLSFPLGSILSSQTQSLSYNTR + Deamidated (NQ) |
| 1213 |
794.3693 | 793.3620 | 793.3640 | -2.49 | 0 | 4 | 0.62 | 1Score > 21 indicates identity Score > 14 indicates homology |
QLGDSMK + Oxidation (M) |
| 952 |
529.2993 | 528.2920 | 528.3020 | -18.9 | 0 | 4 | 1.7 | 1Score > 18 indicates identity |
AVPSR |
| 3588 |
686.6617 | 2056.9633 | 2056.9371 | 12.7 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
SMTPFSAGNTSSQNKLENK + Deamidated (NQ); Oxidation (M) |
| 1399 |
442.7286 | 883.4426 | 883.4399 | 3.08 | 1 | 4 | 2.2 | 1Score > 19 indicates identity |
KDIDEHK |
| 2079 |
1096.5520 | 1095.5447 | 1095.5271 | 16.1 | 0 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
ISDFVCLDK |
| 1324 |
427.2303 | 852.4460 | 852.4527 | -7.85 | 1 | 4 | 2.1 | 1Score > 19 indicates identity |
KIASFCK |
| 2910 |
783.3691 | 1564.7236 | 1564.7524 | -18.4 | 1 | 4 | 0.78 | 1Score > 22 indicates identity Score > 15 indicates homology |
MQNVCGDMTRILK |
| 3624 |
1036.5026 | 2070.9906 | 2070.9965 | -2.84 | 1 | 4 | 0.57 | 1Score > 22 indicates identity Score > 14 indicates homology |
KNEVALMNVIETIMYDR + Deamidated (NQ); 2 Oxidation (M) |
| 3041 |
824.9069 | 1647.7992 | 1647.8146 | -9.33 | 0 | 4 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
ILQMGAIMNLGMPSR + Deamidated (NQ); Oxidation (M) |
| 1116 |
725.3946 | 724.3873 | 724.3980 | -14.7 | 1 | 4 | 1.9 | 1Score > 19 indicates identity |
GNKHLR + Deamidated (NQ) |
| 3278 |
919.4523 | 1836.8900 | 1836.9073 | -9.41 | 1 | 4 | 0.5 | 1Score > 22 indicates identity Score > 13 indicates homology |
ISDSTLNKILDMSMNR |
| 2073 |
1095.5247 | 1094.5174 | 1094.5131 | 3.92 | 0 | 3 | 0.73 | 1Score > 22 indicates identity Score > 15 indicates homology |
LDSFEENIK + Deamidated (NQ) |
| 2954 |
794.9249 | 1587.8352 | 1587.8290 | 3.92 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
LGAVTGLDLAQNCKK + Deamidated (NQ) |
| 2242 |
569.7789 | 1137.5432 | 1137.5302 | 11.5 | 0 | 3 | 0.81 | 1Score > 22 indicates identity Score > 15 indicates homology |
SYSVNSEQPK |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/