MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 2
MS data file : PRT1245_Other_P1_B10.mgf
Database : S-cerevisiae-S288C 20191206 (6,886 sequences; 3,133,934 residues)
Timestamp : 24 Jun 2025 at 21:21:38 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,780

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 601–700 (out of 4764)

Page: Previous 1 …2 3 4 5 6 7 8 9 10 11 12 … 48 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
3132 521.6004 1561.7794 1561.7997 -13.0 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 VLQTMSFLMNHLI + Oxidation (M)
886 639.3131 638.3058 638.3024 5.41 0 0 2.3 +1Score > 16 indicates identity QSYNK
3075 765.9039 1529.7932 1529.7937 -0.30 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 ENQVVVIIGETGSGK + Deamidated (NQ)
3361 863.9596 1725.9046 1725.9148 -5.91 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 LNVLQLSTPQQNELK + 2 Deamidated (NQ)
4170 775.7148 2324.1226 2324.0842 16.5 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 QFLQQQNEASLLNESMDALK + 2 Deamidated (NQ); Oxidation (M)
3026 752.8714 1503.7282 1503.7425 -9.50 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 SPTGIVLMNMGGPSK + Oxidation (M)
4693 1184.5721 3550.6945 3550.7589 -18.1 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 IAYTFGWEGPALTVDTACSSSLVGIHLAMQALR + Oxidation (M)
1172 801.3753 800.3680 800.3817 -17.1 0 0 1.9 +1Score > 16 indicates identity ENWPQK
2232 1094.5320 1093.5247 1093.5114 12.2 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 MSGQLVQWK + 2 Deamidated (NQ); Oxidation (M)
2281 553.2939 1104.5732 1104.5788 -5.04 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 QRSFNANLR
3093 768.8679 1535.7212 1535.7507 -19.2 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 YGLPQLPEEEYAK
3165 793.8901 1585.7656 1585.7736 -5.02 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 GYSYTDANINKNVK
959 339.6643 677.3140 677.3166 -3.84 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 MSTPAR + Oxidation (M)
1169 400.7175 799.4204 799.4301 -12.0 0 0 3.6 +1Score > 18 indicates identity LLGGGGGGGR
2221 1093.5109 1092.5036 1092.4948 8.07 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 QPPETNHNR + Deamidated (NQ)
1910 1024.5101 1023.5028 1023.5138 -10.7 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 LSPPGWDPR
3318 847.3832 1692.7518 1692.7559 -2.41 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 ETSNKQTACPICQR + Deamidated (NQ)
2255 550.7842 1099.5538 1099.5444 8.60 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 LRNPSPMER + Deamidated (NQ)
2527 1164.6156 1163.6083 1163.5856 19.5 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 QSGMLTLLER + Deamidated (NQ); Oxidation (M)
3989 724.3735 2170.0987 2170.0654 15.3 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 DVGNGRHETSTFLGLINPNK + 2 Deamidated (NQ)
4010 731.3586 2191.0540 2191.0766 -10.3 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 GIELFGAVCKSHAITNNITM + Oxidation (M)
2620 395.5051 1183.4935 1183.4993 -4.90 1 0 1.7 +1Score > 15 indicates identity SENYLNGRQT + 3 Deamidated (NQ)
2013 524.7632 1047.5118 1047.5026 8.86 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 GPFNWTVEV
2636 594.3178 1186.6210 1186.6306 -8.01 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 RNEELSGALAK
1236 421.1889 840.3632 840.3647 -1.76 0 0 2.7 +1Score > 17 indicates identity TTGSMSNK + Oxidation (M)
1503 464.7414 927.4682 927.4702 -2.09 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 STAFDFLK
2199 544.7732 1087.5318 1087.5397 -7.20 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 LNGQLNLEGK + 3 Deamidated (NQ)
4321 862.7191 2585.1355 2585.1553 -7.67 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 MQFFNGVIEDSLIPNVNAMGQPK + 5 Deamidated (NQ); 2 Oxidation (M)
2844 678.3332 1354.6518 1354.6477 3.08 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 SAKNSGHNDPLSK + Deamidated (NQ)
2380 567.2847 1132.5548 1132.5335 18.8 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 MEAHNQFLK + Oxidation (M)
4139 1152.0784 2302.1422 2302.1515 -4.01 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 LSMESPHVNVFSILTDLDIR + Deamidated (NQ); Oxidation (M)
894 641.3375 640.3302 640.3333 -4.78 0 0 0.99 +1Score > 20 indicates identity
Score > 13 indicates homology		 WNPPK
2349 562.8294 1123.6442 1123.6601 -14.1 0 0 2.2 +1Score > 16 indicates identity VVVATSLNPPK
2731 625.3372 1248.6598 1248.6350 19.9 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 ELNLGKDEFGK
1118 778.3750 777.3677 777.3691 -1.72 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 KLDNCK + Deamidated (NQ)
4196 591.2726 2361.0613 2361.0291 13.6 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 APMGANAAVDNNAAGGGEFNDPRK + 2 Deamidated (NQ); Oxidation (M)
4280 830.4541 2488.3405 2488.3365 1.58 1 0 3.4 +1Score > 18 indicates identity YLFIAQAQKALINVYNLSGSFK + Deamidated (NQ)
2525 582.8090 1163.6034 1163.6009 2.22 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 QFLQLQMEK
3015 499.2513 1494.7321 1494.7428 -7.19 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 ESLPPALQMAFYK + Deamidated (NQ)
4361 898.4511 2692.3315 2692.3668 -13.1 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 TNLTTTLTQFHETVATISSSNARAK + Deamidated (NQ)
4594 1071.2163 3210.6271 3210.5794 14.8 1 0 4.7 +1Score > 19 indicates identity FNDSMVSSISQEEVLKEQAYLLFYTIR + Deamidated (NQ)
2432 573.3216 1144.6286 1144.6339 -4.58 1 0 0.98 +1Score > 22 indicates identity
Score > 13 indicates homology		 QNAIIKLSQK + 3 Deamidated (NQ)
1581 474.2335 946.4524 946.4607 -8.73 0 0 0.99 +1Score > 22 indicates identity
Score > 13 indicates homology		 NLTEENVK + Deamidated (NQ)
4416 701.3442 2801.3477 2801.3258 7.81 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 NNLLYFQMWTEVEILQDDLSWK + Deamidated (NQ); Oxidation (M)
4335 871.7382 2612.1928 2612.2397 -17.9 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 MMGKSPQQQQQQNTPLMPPADIK + Deamidated (NQ); Oxidation (M)
2929 723.8641 1445.7136 1445.7335 -13.7 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 NNLLQSNSSASRR
2981 733.8439 1465.6732 1465.6732 0.042 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 SDPGLQRNNMYR + Oxidation (M)
2597 1179.5627 1178.5554 1178.5601 -3.97 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 TSNNKQVMEK + Deamidated (NQ)
3123 519.9186 1556.7340 1556.7471 -8.40 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 QNLPQLEHSSFEK + Deamidated (NQ)
3346 571.6123 1711.8151 1711.8199 -2.82 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 IMSNHDPSELSNGAIK
2480 578.2701 1154.5256 1154.5105 13.1 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology		 HNLADQDWR + Deamidated (NQ)
1893 1021.5491 1020.5418 1020.5240 17.5 0 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology		 ETALDFIGR
2775 643.8293 1285.6440 1285.6374 5.14 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 INGNGKNNIDAR + Deamidated (NQ)
2800 658.3114 1314.6082 1314.5840 18.4 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 EDAPDLDWGAAR
2972 487.5851 1459.7335 1459.7154 12.4 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 INGLNSNNSIIGNK + 3 Deamidated (NQ)
3081 767.3748 1532.7350 1532.7293 3.75 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 SYKANQPSPGEMPK
3219 810.9081 1619.8016 1619.8155 -8.54 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 DLSDEEFRILVQR + Deamidated (NQ)
3595 968.4989 1934.9832 1934.9989 -8.10 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 EGVIKEFTGISAPYEAPK
2941 723.8749 1445.7352 1445.7085 18.5 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 SHGAVLPSYCSLR
3169 794.9078 1587.8010 1587.8256 -15.5 1 0 1 +1Score > 24 indicates identity
Score > 13 indicates homology		 AAQNPLADIQVYKR + 2 Deamidated (NQ)
4708 923.2026 3688.7813 3688.8056 -6.58 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology		 HLNMTVAELFLDIHAIYEEQQGSRNSKPNYR + Oxidation (M)
835 598.3321 597.3248 597.3235 2.29 0 0 4.3 +1Score > 19 indicates identity GAPPTR
2829 672.8275 1343.6404 1343.6510 -7.84 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 DGEWLYHISPK
2554 586.2714 1170.5282 1170.5517 -20.0 0 0 3.3 +1Score > 18 indicates identity IGGVNNPEQNK + 2 Deamidated (NQ)
3680 998.4747 1994.9348 1994.9619 -13.6 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 GIVDIYSNDVMIIDNNGK + Oxidation (M)
4679 878.4317 3509.6977 3509.7534 -15.9 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology		 QVESSQSMIRIIGLSATLPNFMDVADFLGVNR + 2 Deamidated (NQ)
1 300.2086 299.2013
2 301.1436 300.1363
3 301.1436 300.1363
4 301.1437 300.1364
5 301.1440 300.1367
6 301.1440 300.1367
7 301.1440 300.1367
8 301.1444 300.1371
9 301.2213 300.2140
10 303.8864 302.8791
11 303.8865 302.8792
12 303.8866 302.8793
13 303.8867 302.8794
14 303.8869 302.8796
15 303.8870 302.8797
16 303.8871 302.8798
17 303.8872 302.8799
18 305.1746 304.1673
19 305.1748 304.1675
20 305.1750 304.1677
21 305.1751 304.1678
22 305.1754 304.1681
23 305.1756 304.1683
24 305.1758 304.1685
25 305.1758 304.1685
26 305.1758 304.1685
27 305.1759 304.1686
28 305.1949 304.1876
29 305.2109 304.2036
30 307.1540 306.1467
31 307.1545 306.1472
32 307.1550 306.1477
33 307.1898 306.1825
34 307.1907 306.1834
Page: Previous 1 …2 3 4 5 6 7 8 9 10 11 12 … 48 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/