MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 2
MS data file : PRT1245_Other_P1_B10.mgf
Database : S-cerevisiae-S288C 20191206 (6,886 sequences; 3,133,934 residues)
Timestamp : 24 Jun 2025 at 21:21:38 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,780

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 501–600 (out of 4764)


Page: Previous 1 2 3 4 5 6 7 8 9 10 11  48 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2798 657.8066 1313.5986 1313.6186 -15.2 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
FRMNFEQGLR + Deamidated (NQ); Oxidation (M)
1713 491.7274 981.4402 981.4226 18.0 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
QGNEQMFK + Deamidated (NQ)
3578 960.4537 1918.8928 1918.8917 0.62 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology
GLHLNEDIYAGMNAMLR + 2 Deamidated (NQ)
4169 775.7148 2324.1226 2324.1610 -16.5 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
TVAGFSNVELPQCIIPSSYIK + 2 Deamidated (NQ)
2935 723.8716 1445.7286 1445.7085 13.9 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology
SHGAVLPSYCSLR
4653 858.4391 3429.7273 3429.7523 -7.30 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
NITDNPQLSNSIEITWLLRLLDVMVCNIK + 2 Deamidated (NQ); Oxidation (M)
3301 842.4396 1682.8646 1682.8951 -18.1 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
ISIIEENSPERQIR
4146 1154.0629 2306.1112 2306.0961 6.59 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology
HINNSHLQGPNQETIEMKSK + 2 Deamidated (NQ)
1057 742.3375 741.3302 741.3333 -4.21 0 1 2.1 +1Score > 17 indicates identity GEFFNK + Deamidated (NQ)
3670 664.3062 1989.8968 1989.9062 -4.72 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
KQLAQDQMSTTGSNSAGHK + 2 Deamidated (NQ)
1350 441.7254 881.4362 881.4494 -14.9 1 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
KLDESYK
3129 781.8941 1561.7736 1561.7592 9.23 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology
IICPSVESISNGMR
1226 419.2141 836.4136 836.4140 -0.48 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology
HLDAEPR
4002 1090.5364 2179.0582 2179.0320 12.0 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology
EWFDEEISLLKLEQNER + 2 Deamidated (NQ)
2917 718.3453 1434.6760 1434.6990 -16.0 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology
NAGISLPEISNYR + 2 Deamidated (NQ)
2193 544.2858 1086.5570 1086.5709 -12.8 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology
EHTIIAEFK
4233 809.3663 2425.0771 2425.1049 -11.5 1 1 3.4 +1Score > 19 indicates identity LMENHACNGLTSCKEQLHQR
4149 1155.0696 2308.1246 2308.0820 18.5 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology
NKGLTYNDTMLYYLNLPQK + 4 Deamidated (NQ); Oxidation (M)
1378 446.2252 890.4358 890.4531 -19.4 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology
GLMISGGEK
1542 938.4509 937.4436 937.4426 1.06 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology
LSEDMSLK + Oxidation (M)
2828 672.8266 1343.6386 1343.6510 -9.18 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
DGEWLYHISPK
3511 926.4553 1850.8960 1850.9044 -4.49 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology
VTNVNATASMLNNISSSK + Deamidated (NQ)
3167 794.9061 1587.7976 1587.8256 -17.6 1 1 1 +1Score > 24 indicates identity
Score > 14 indicates homology
AAQNPLADIQVYKR + 2 Deamidated (NQ)
3606 971.4929 1940.9712 1940.9370 17.7 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
KVTQMANAMVTSLGMSPK + 3 Oxidation (M)
3663 993.4766 1984.9386 1984.9313 3.72 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
DVQYDAACADLRISFNK
1881 1019.4826 1018.4753 1018.4931 -17.4 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology
SQAEQEKAK + Deamidated (NQ)
1052 370.7009 739.3872 739.3752 16.3 0 1 3.2 +1Score > 19 indicates identity QYSTLK + Deamidated (NQ)
1444 911.4598 910.4525 910.4621 -10.5 0 1 3.9 +1Score > 20 indicates identity QIVHDSGR
2617 592.3644 1182.7142 1182.7012 11.0 1 1 1.5 +1Score > 15 indicates identity VKLAVLSYYK
1772 498.7419 995.4692 995.4560 13.3 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
QGLEGNSYK + Deamidated (NQ)
4127 1149.0887 2296.1628 2296.2023 -17.2 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology
SEVNAKSLLGSRPEQDTGAPIK
3002 743.3442 1484.6738 1484.6929 -12.8 0 1 1 +1Score > 20 indicates identity
Score > 14 indicates homology
MGAISSQLASYDSR
4386 690.0897 2756.3297 2756.2866 15.6 0 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
AEQYMIDTLEFEIGWPGPMPFLR + Deamidated (NQ); Oxidation (M)
3138 782.4104 1562.8062 1562.7940 7.83 0 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology
NDTQLQLIVNYNK + Deamidated (NQ)
1602 476.2161 950.4176 950.4280 -10.9 1 1 2.9 +1Score > 18 indicates identity NKNDWMK + Oxidation (M)
2410 571.7580 1141.5014 1141.5000 1.30 0 1 2.9 +1Score > 18 indicates identity GEPSEPQQDR
2729 625.3339 1248.6532 1248.6350 14.6 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
ELNLGKDEFGK
4624 1123.2041 3366.5905 3366.6289 -11.4 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
ESVPFLRNSISQHDLSNVTTTPVPAGMPPQK + 4 Deamidated (NQ); Oxidation (M)
1395 898.3911 897.3838 897.3716 13.7 0 1 2.8 +1Score > 18 indicates identity ADSGYEEK
4284 832.4235 2494.2487 2494.2486 0.042 1 1 0.83 +1Score > 21 indicates identity
Score > 13 indicates homology
NEVTCSITGDNPIHKINNGLGLK + Deamidated (NQ)
1508 465.7310 929.4474 929.4315 17.2 0 1 3.4 +1Score > 19 indicates identity GAGAEAGNQR
2154 540.2597 1078.5048 1078.4964 7.81 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
QLSMKNNDK + 2 Deamidated (NQ)
1078 754.3375 753.3302 753.3268 4.51 0 1 1.9 +1Score > 16 indicates identity NWFCK
4116 1147.5597 2293.1048 2293.0619 18.7 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
AGNAHMLDGKWSNNPPQMVPK + 2 Deamidated (NQ)
1446 456.2342 910.4538 910.4508 3.31 0 1 4.1 +1Score > 20 indicates identity DLEVNGHK
1818 503.7307 1005.4468 1005.4549 -8.00 0 1 3.9 +1Score > 19 indicates identity MNSLANNNK + Deamidated (NQ)
2823 669.3467 1336.6788 1336.6834 -3.40 1 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology
KESGLTSNSLSSK
4478 984.8282 2951.4628 2951.4584 1.47 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
TSVQNSPRLQQPQEQQQQQQQLSLK + 3 Deamidated (NQ)
1622 478.7624 955.5102 955.5127 -2.56 0 1 2.9 +1Score > 18 indicates identity NVPIWAQK + Deamidated (NQ)
2758 636.3032 1270.5918 1270.5789 10.2 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
NGQASAPRPNQK + 4 Deamidated (NQ)
1361 443.2764 884.5382 884.5443 -6.86 1 1 3.4 +1Score > 19 indicates identity NQAIKALK
1817 336.1556 1005.4450 1005.4549 -9.87 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
MNSLANNNK + Deamidated (NQ)
1056 742.3373 741.3300 741.3333 -4.48 0 1 2.3 +1Score > 17 indicates identity GEFFNK + Deamidated (NQ)
3615 651.3247 1950.9523 1950.9794 -13.9 0 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
SYLAPIMSIPLNDCTLK + Oxidation (M)
1112 772.3483 771.3410 771.3511 -13.1 0 1 1.6 +1Score > 15 indicates identity NGNVPNR + 2 Deamidated (NQ)
2479 578.2640 1154.5134 1154.5311 -15.3 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
SMQISEMGKK + Deamidated (NQ); Oxidation (M)
2753 635.8055 1269.5964 1269.5798 13.1 0 1 0.9 +1Score > 22 indicates identity
Score > 13 indicates homology
YINDDEMILK + Deamidated (NQ); Oxidation (M)
2414 571.7631 1141.5116 1141.5251 -11.8 0 1 4.2 +1Score > 20 indicates identity TASAPNSGNPPK + 2 Deamidated (NQ)
2857 687.3440 1372.6734 1372.6582 11.1 1 1 0.85 +1Score > 22 indicates identity
Score > 13 indicates homology
NIEASVQPSRDR + 2 Deamidated (NQ)
3166 794.4257 1586.8368 1586.8668 -18.9 0 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
ANSSAFDGLLALIPAK
4455 973.8657 2918.5753 2918.5337 14.2 1 1 2.8 +1Score > 18 indicates identity HVWCSDIIRNLGGNISHGLLFQILR + Deamidated (NQ)
1460 458.2380 914.4614 914.4709 -10.3 0 1 3.3 +1Score > 18 indicates identity VADGSLEPK
2711 618.8025 1235.5904 1235.5935 -2.45 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
RFWQSETGPK + Deamidated (NQ)
3231 543.5922 1627.7548 1627.7399 9.11 0 1 0.95 +1Score > 22 indicates identity
Score > 13 indicates homology
TQGYTVADCTAEAIK + Deamidated (NQ)
4503 993.4523 2977.3351 2977.3208 4.78 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
THQPEQYDIPTDMSPLMTIAASESADK + 2 Deamidated (NQ)
1915 513.2947 1024.5748 1024.5553 19.1 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
QPQQAKVPK + 2 Deamidated (NQ)
2280 553.2916 1104.5686 1104.5788 -9.20 1 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology
QRSFNANLR
3536 938.4494 1874.8842 1874.8799 2.33 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
YDNPTGGVYQVYNTRK + Deamidated (NQ)
1454 457.2286 912.4426 912.4263 18.0 0 1 4 +1Score > 19 indicates identity IFTEEMK + Oxidation (M)
1277 428.2003 854.3860 854.4030 -19.9 0 1 3.3 +1Score > 18 indicates identity GQFLMMK + Deamidated (NQ)
2942 723.8749 1445.7352 1445.7085 18.5 0 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
SHGAVLPSYCSLR
3594 968.4534 1934.8922 1934.9255 -17.2 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
GELNSVDDALEKTMIER + Oxidation (M)
3402 587.5720 1759.6942 1759.6843 5.64 0 1 1 +1Score > 13 indicates identity MQPHLDNNSNNDDVK + 4 Deamidated (NQ); Oxidation (M)
4027 735.3270 2202.9592 2202.9813 -10.1 0 1 2.9 +1Score > 18 indicates identity GANIASFVMVADAMLDQGDVF + Deamidated (NQ); 2 Oxidation (M)
3914 709.0472 2124.1198 2124.0851 16.3 1 1 4.1 +1Score > 19 indicates identity NLPNTSSIINAIKYEYQR + Deamidated (NQ)
2786 434.2116 1299.6130 1299.6207 -5.98 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
ASNLEHGFNPSK
1070 372.6872 743.3598 743.3490 14.6 0 1 3.3 +1Score > 18 indicates identity EGTYFK
4448 963.2024 2886.5854 2886.5590 9.15 1 1 1.4 +1Score > 15 indicates identity TLLQIQAYEDEDKEVPIISTLIISR
2081 1061.5192 1060.5119 1060.5288 -15.9 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
ESVIEEDLK
3134 781.9019 1561.7892 1561.8100 -13.3 1 1 0.93 +1Score > 23 indicates identity
Score > 13 indicates homology
DINDININFAAKSK
2071 530.7390 1059.4634 1059.4729 -8.92 0 1 2.6 +1Score > 17 indicates identity FCMSASLTK + Oxidation (M)
3392 585.2657 1752.7753 1752.7955 -11.5 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
LNGQEDRFLSGSWDK + 2 Deamidated (NQ)
1258 848.4064 847.3991 847.3923 8.07 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
AQQDKEK + 2 Deamidated (NQ)
4422 941.4614 2821.3624 2821.3188 15.4 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
QPKSPNSNLAGHQSMADNPAELSDALK + 2 Deamidated (NQ)
3493 920.4440 1838.8734 1838.8898 -8.88 0 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
NNSDYDQVNLLTTTIK + Deamidated (NQ)
3679 998.4723 1994.9300 1994.9480 -8.99 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
MSNVVQARDNSQVFGVAR + 2 Deamidated (NQ); Oxidation (M)
2974 487.6018 1459.7836 1459.8034 -13.6 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
LNLVQRNVNIFK + 3 Deamidated (NQ)
4351 883.8013 2648.3821 2648.3962 -5.34 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
LYQFHAIVVTLPGTPQTEHLINR + 2 Deamidated (NQ)
913 655.3056 654.2983 654.2973 1.58 0 1 4.1 +1Score > 19 indicates identity GSYSNK
1129 783.3635 782.3562 782.3711 -19.1 0 1 3.3 +1Score > 18 indicates identity QDAFFR
2782 649.3158 1296.6170 1296.6098 5.58 1 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology
KLSSHNQYYR + 2 Deamidated (NQ)
1219 834.3911 833.3838 833.3953 -13.7 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
GQLGEMAK + Deamidated (NQ)
3240 544.9421 1631.8045 1631.7791 15.5 0 1 0.92 +1Score > 23 indicates identity
Score > 13 indicates homology
LDDLEYIDSHGISR
3748 683.6575 2047.9507 2047.9561 -2.64 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
DVITGMNNWSIKFSEYK + Deamidated (NQ); Oxidation (M)
4593 1070.8921 3209.6545 3209.6642 -3.03 1 0 3.6 +1Score > 19 indicates identity EASEILAGLQGILPMDISVHQVDGGLKVYR + 2 Deamidated (NQ)
2872 695.3854 1388.7562 1388.7333 16.5 0 0 0.95 +1Score > 21 indicates identity
Score > 13 indicates homology
MSTIGAVDILNQK
3631 655.9687 1964.8843 1964.8938 -4.86 1 0 0.95 +1Score > 21 indicates identity
Score > 13 indicates homology
RAQYDSCDFVADVPPPK + Deamidated (NQ)
2860 690.3262 1378.6378 1378.6398 -1.45 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
VDAMGVESTGIQR + Deamidated (NQ); Oxidation (M)
1838 504.7653 1007.5160 1007.5036 12.4 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
ILNNESYR
3061 760.3810 1518.7474 1518.7613 -9.10 1 0 1 +1Score > 24 indicates identity
Score > 13 indicates homology
MSQKIGHSGLAFAR + Deamidated (NQ); Oxidation (M)
Page: Previous 1 2 3 4 5 6 7 8 9 10 11  48 Next 

Not what you expected? Try the select summary.