| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 2 |
| MS data file | : | PRT1245_Other_P1_B10.mgf |
| Database | : | S-cerevisiae-S288C 20191206 (6,886 sequences; 3,133,934 residues) |
| Timestamp | : | 24 Jun 2025 at 21:21:38 GMT |
Not what you expected? Try
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | |
| Variable modifications | : | |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,780 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 | 2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | ||||
| 6.2e-007 | 1 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | ||||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle (
) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 657.8066 | 1313.5986 | 1313.6186 | -15.2 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 14 indicates homology |
FRMNFEQGLR + Deamidated (NQ); Oxidation (M) | |
| 491.7274 | 981.4402 | 981.4226 | 18.0 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 14 indicates homology |
QGNEQMFK + Deamidated (NQ) | |
| 960.4537 | 1918.8928 | 1918.8917 | 0.62 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 14 indicates homology |
GLHLNEDIYAGMNAMLR + 2 Deamidated (NQ) | |
| 775.7148 | 2324.1226 | 2324.1610 | -16.5 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 14 indicates homology |
TVAGFSNVELPQCIIPSSYIK + 2 Deamidated (NQ) | |
| 723.8716 | 1445.7286 | 1445.7085 | 13.9 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 14 indicates homology |
SHGAVLPSYCSLR | |
| 858.4391 | 3429.7273 | 3429.7523 | -7.30 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 14 indicates homology |
NITDNPQLSNSIEITWLLRLLDVMVCNIK + 2 Deamidated (NQ); Oxidation (M) | |
| 842.4396 | 1682.8646 | 1682.8951 | -18.1 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 14 indicates homology |
ISIIEENSPERQIR | |
| 1154.0629 | 2306.1112 | 2306.0961 | 6.59 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 14 indicates homology |
HINNSHLQGPNQETIEMKSK + 2 Deamidated (NQ) | |
| 742.3375 | 741.3302 | 741.3333 | -4.21 | 0 | 1 | 2.1 | 1Score > 17 indicates identity |
GEFFNK + Deamidated (NQ) | |
| 664.3062 | 1989.8968 | 1989.9062 | -4.72 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 14 indicates homology |
KQLAQDQMSTTGSNSAGHK + 2 Deamidated (NQ) | |
| 441.7254 | 881.4362 | 881.4494 | -14.9 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 14 indicates homology |
KLDESYK | |
| 781.8941 | 1561.7736 | 1561.7592 | 9.23 | 0 | 1 | 1 | 1Score > 23 indicates identityScore > 14 indicates homology |
IICPSVESISNGMR | |
| 419.2141 | 836.4136 | 836.4140 | -0.48 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 14 indicates homology |
HLDAEPR | |
| 1090.5364 | 2179.0582 | 2179.0320 | 12.0 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 14 indicates homology |
EWFDEEISLLKLEQNER + 2 Deamidated (NQ) | |
| 718.3453 | 1434.6760 | 1434.6990 | -16.0 | 0 | 1 | 1 | 1Score > 23 indicates identityScore > 14 indicates homology |
NAGISLPEISNYR + 2 Deamidated (NQ) | |
| 544.2858 | 1086.5570 | 1086.5709 | -12.8 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 14 indicates homology |
EHTIIAEFK | |
| 809.3663 | 2425.0771 | 2425.1049 | -11.5 | 1 | 1 | 3.4 | 1Score > 19 indicates identity |
LMENHACNGLTSCKEQLHQR | |
| 1155.0696 | 2308.1246 | 2308.0820 | 18.5 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 14 indicates homology |
NKGLTYNDTMLYYLNLPQK + 4 Deamidated (NQ); Oxidation (M) | |
| 446.2252 | 890.4358 | 890.4531 | -19.4 | 0 | 1 | 1 | 1Score > 23 indicates identityScore > 14 indicates homology |
GLMISGGEK | |
| 938.4509 | 937.4436 | 937.4426 | 1.06 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 14 indicates homology |
LSEDMSLK + Oxidation (M) | |
| 672.8266 | 1343.6386 | 1343.6510 | -9.18 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 14 indicates homology |
DGEWLYHISPK | |
| 926.4553 | 1850.8960 | 1850.9044 | -4.49 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 14 indicates homology |
VTNVNATASMLNNISSSK + Deamidated (NQ) | |
| 794.9061 | 1587.7976 | 1587.8256 | -17.6 | 1 | 1 | 1 | 1Score > 24 indicates identityScore > 14 indicates homology |
AAQNPLADIQVYKR + 2 Deamidated (NQ) | |
| 971.4929 | 1940.9712 | 1940.9370 | 17.7 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 14 indicates homology |
KVTQMANAMVTSLGMSPK + 3 Oxidation (M) | |
| 993.4766 | 1984.9386 | 1984.9313 | 3.72 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 14 indicates homology |
DVQYDAACADLRISFNK | |
| 1019.4826 | 1018.4753 | 1018.4931 | -17.4 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 14 indicates homology |
SQAEQEKAK + Deamidated (NQ) | |
| 370.7009 | 739.3872 | 739.3752 | 16.3 | 0 | 1 | 3.2 | 1Score > 19 indicates identity |
QYSTLK + Deamidated (NQ) | |
| 911.4598 | 910.4525 | 910.4621 | -10.5 | 0 | 1 | 3.9 | 1Score > 20 indicates identity |
QIVHDSGR | |
| 592.3644 | 1182.7142 | 1182.7012 | 11.0 | 1 | 1 | 1.5 | 1Score > 15 indicates identity |
VKLAVLSYYK | |
| 498.7419 | 995.4692 | 995.4560 | 13.3 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 14 indicates homology |
QGLEGNSYK + Deamidated (NQ) | |
| 1149.0887 | 2296.1628 | 2296.2023 | -17.2 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 14 indicates homology |
SEVNAKSLLGSRPEQDTGAPIK | |
| 743.3442 | 1484.6738 | 1484.6929 | -12.8 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 14 indicates homology |
MGAISSQLASYDSR | |
| 690.0897 | 2756.3297 | 2756.2866 | 15.6 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
AEQYMIDTLEFEIGWPGPMPFLR + Deamidated (NQ); Oxidation (M) | |
| 782.4104 | 1562.8062 | 1562.7940 | 7.83 | 0 | 1 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
NDTQLQLIVNYNK + Deamidated (NQ) | |
| 476.2161 | 950.4176 | 950.4280 | -10.9 | 1 | 1 | 2.9 | 1Score > 18 indicates identity |
NKNDWMK + Oxidation (M) | |
| 571.7580 | 1141.5014 | 1141.5000 | 1.30 | 0 | 1 | 2.9 | 1Score > 18 indicates identity |
GEPSEPQQDR | |
| 625.3339 | 1248.6532 | 1248.6350 | 14.6 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
ELNLGKDEFGK | |
| 1123.2041 | 3366.5905 | 3366.6289 | -11.4 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
ESVPFLRNSISQHDLSNVTTTPVPAGMPPQK + 4 Deamidated (NQ); Oxidation (M) | |
| 898.3911 | 897.3838 | 897.3716 | 13.7 | 0 | 1 | 2.8 | 1Score > 18 indicates identity |
ADSGYEEK | |
| 832.4235 | 2494.2487 | 2494.2486 | 0.042 | 1 | 1 | 0.83 | 1Score > 21 indicates identityScore > 13 indicates homology |
NEVTCSITGDNPIHKINNGLGLK + Deamidated (NQ) | |
| 465.7310 | 929.4474 | 929.4315 | 17.2 | 0 | 1 | 3.4 | 1Score > 19 indicates identity |
GAGAEAGNQR | |
| 540.2597 | 1078.5048 | 1078.4964 | 7.81 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
QLSMKNNDK + 2 Deamidated (NQ) | |
| 754.3375 | 753.3302 | 753.3268 | 4.51 | 0 | 1 | 1.9 | 1Score > 16 indicates identity |
NWFCK | |
| 1147.5597 | 2293.1048 | 2293.0619 | 18.7 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
AGNAHMLDGKWSNNPPQMVPK + 2 Deamidated (NQ) | |
| 456.2342 | 910.4538 | 910.4508 | 3.31 | 0 | 1 | 4.1 | 1Score > 20 indicates identity |
DLEVNGHK | |
| 503.7307 | 1005.4468 | 1005.4549 | -8.00 | 0 | 1 | 3.9 | 1Score > 19 indicates identity |
MNSLANNNK + Deamidated (NQ) | |
| 669.3467 | 1336.6788 | 1336.6834 | -3.40 | 1 | 1 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
KESGLTSNSLSSK | |
| 984.8282 | 2951.4628 | 2951.4584 | 1.47 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
TSVQNSPRLQQPQEQQQQQQQLSLK + 3 Deamidated (NQ) | |
| 478.7624 | 955.5102 | 955.5127 | -2.56 | 0 | 1 | 2.9 | 1Score > 18 indicates identity |
NVPIWAQK + Deamidated (NQ) | |
| 636.3032 | 1270.5918 | 1270.5789 | 10.2 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
NGQASAPRPNQK + 4 Deamidated (NQ) | |
| 443.2764 | 884.5382 | 884.5443 | -6.86 | 1 | 1 | 3.4 | 1Score > 19 indicates identity |
NQAIKALK | |
| 336.1556 | 1005.4450 | 1005.4549 | -9.87 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
MNSLANNNK + Deamidated (NQ) | |
| 742.3373 | 741.3300 | 741.3333 | -4.48 | 0 | 1 | 2.3 | 1Score > 17 indicates identity |
GEFFNK + Deamidated (NQ) | |
| 651.3247 | 1950.9523 | 1950.9794 | -13.9 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
SYLAPIMSIPLNDCTLK + Oxidation (M) | |
| 772.3483 | 771.3410 | 771.3511 | -13.1 | 0 | 1 | 1.6 | 1Score > 15 indicates identity |
NGNVPNR + 2 Deamidated (NQ) | |
| 578.2640 | 1154.5134 | 1154.5311 | -15.3 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
SMQISEMGKK + Deamidated (NQ); Oxidation (M) | |
| 635.8055 | 1269.5964 | 1269.5798 | 13.1 | 0 | 1 | 0.9 | 1Score > 22 indicates identityScore > 13 indicates homology |
YINDDEMILK + Deamidated (NQ); Oxidation (M) | |
| 571.7631 | 1141.5116 | 1141.5251 | -11.8 | 0 | 1 | 4.2 | 1Score > 20 indicates identity |
TASAPNSGNPPK + 2 Deamidated (NQ) | |
| 687.3440 | 1372.6734 | 1372.6582 | 11.1 | 1 | 1 | 0.85 | 1Score > 22 indicates identityScore > 13 indicates homology |
NIEASVQPSRDR + 2 Deamidated (NQ) | |
| 794.4257 | 1586.8368 | 1586.8668 | -18.9 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
ANSSAFDGLLALIPAK | |
| 973.8657 | 2918.5753 | 2918.5337 | 14.2 | 1 | 1 | 2.8 | 1Score > 18 indicates identity |
HVWCSDIIRNLGGNISHGLLFQILR + Deamidated (NQ) | |
| 458.2380 | 914.4614 | 914.4709 | -10.3 | 0 | 1 | 3.3 | 1Score > 18 indicates identity |
VADGSLEPK | |
| 618.8025 | 1235.5904 | 1235.5935 | -2.45 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
RFWQSETGPK + Deamidated (NQ) | |
| 543.5922 | 1627.7548 | 1627.7399 | 9.11 | 0 | 1 | 0.95 | 1Score > 22 indicates identityScore > 13 indicates homology |
TQGYTVADCTAEAIK + Deamidated (NQ) | |
| 993.4523 | 2977.3351 | 2977.3208 | 4.78 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
THQPEQYDIPTDMSPLMTIAASESADK + 2 Deamidated (NQ) | |
| 513.2947 | 1024.5748 | 1024.5553 | 19.1 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
QPQQAKVPK + 2 Deamidated (NQ) | |
| 553.2916 | 1104.5686 | 1104.5788 | -9.20 | 1 | 1 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
QRSFNANLR | |
| 938.4494 | 1874.8842 | 1874.8799 | 2.33 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
YDNPTGGVYQVYNTRK + Deamidated (NQ) | |
| 457.2286 | 912.4426 | 912.4263 | 18.0 | 0 | 1 | 4 | 1Score > 19 indicates identity |
IFTEEMK + Oxidation (M) | |
| 428.2003 | 854.3860 | 854.4030 | -19.9 | 0 | 1 | 3.3 | 1Score > 18 indicates identity |
GQFLMMK + Deamidated (NQ) | |
| 723.8749 | 1445.7352 | 1445.7085 | 18.5 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
SHGAVLPSYCSLR | |
| 968.4534 | 1934.8922 | 1934.9255 | -17.2 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
GELNSVDDALEKTMIER + Oxidation (M) | |
| 587.5720 | 1759.6942 | 1759.6843 | 5.64 | 0 | 1 | 1 | 1Score > 13 indicates identity |
MQPHLDNNSNNDDVK + 4 Deamidated (NQ); Oxidation (M) | |
| 735.3270 | 2202.9592 | 2202.9813 | -10.1 | 0 | 1 | 2.9 | 1Score > 18 indicates identity |
GANIASFVMVADAMLDQGDVF + Deamidated (NQ); 2 Oxidation (M) | |
| 709.0472 | 2124.1198 | 2124.0851 | 16.3 | 1 | 1 | 4.1 | 1Score > 19 indicates identity |
NLPNTSSIINAIKYEYQR + Deamidated (NQ) | |
| 434.2116 | 1299.6130 | 1299.6207 | -5.98 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
ASNLEHGFNPSK | |
| 372.6872 | 743.3598 | 743.3490 | 14.6 | 0 | 1 | 3.3 | 1Score > 18 indicates identity |
EGTYFK | |
| 963.2024 | 2886.5854 | 2886.5590 | 9.15 | 1 | 1 | 1.4 | 1Score > 15 indicates identity |
TLLQIQAYEDEDKEVPIISTLIISR | |
| 1061.5192 | 1060.5119 | 1060.5288 | -15.9 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
ESVIEEDLK | |
| 781.9019 | 1561.7892 | 1561.8100 | -13.3 | 1 | 1 | 0.93 | 1Score > 23 indicates identityScore > 13 indicates homology |
DINDININFAAKSK | |
| 530.7390 | 1059.4634 | 1059.4729 | -8.92 | 0 | 1 | 2.6 | 1Score > 17 indicates identity |
FCMSASLTK + Oxidation (M) | |
| 585.2657 | 1752.7753 | 1752.7955 | -11.5 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
LNGQEDRFLSGSWDK + 2 Deamidated (NQ) | |
| 848.4064 | 847.3991 | 847.3923 | 8.07 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
AQQDKEK + 2 Deamidated (NQ) | |
| 941.4614 | 2821.3624 | 2821.3188 | 15.4 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
QPKSPNSNLAGHQSMADNPAELSDALK + 2 Deamidated (NQ) | |
| 920.4440 | 1838.8734 | 1838.8898 | -8.88 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
NNSDYDQVNLLTTTIK + Deamidated (NQ) | |
| 998.4723 | 1994.9300 | 1994.9480 | -8.99 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
MSNVVQARDNSQVFGVAR + 2 Deamidated (NQ); Oxidation (M) | |
| 487.6018 | 1459.7836 | 1459.8034 | -13.6 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
LNLVQRNVNIFK + 3 Deamidated (NQ) | |
| 883.8013 | 2648.3821 | 2648.3962 | -5.34 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
LYQFHAIVVTLPGTPQTEHLINR + 2 Deamidated (NQ) | |
| 655.3056 | 654.2983 | 654.2973 | 1.58 | 0 | 1 | 4.1 | 1Score > 19 indicates identity |
GSYSNK | |
| 783.3635 | 782.3562 | 782.3711 | -19.1 | 0 | 1 | 3.3 | 1Score > 18 indicates identity |
QDAFFR | |
| 649.3158 | 1296.6170 | 1296.6098 | 5.58 | 1 | 1 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
KLSSHNQYYR + 2 Deamidated (NQ) | |
| 834.3911 | 833.3838 | 833.3953 | -13.7 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
GQLGEMAK + Deamidated (NQ) | |
| 544.9421 | 1631.8045 | 1631.7791 | 15.5 | 0 | 1 | 0.92 | 1Score > 23 indicates identityScore > 13 indicates homology |
LDDLEYIDSHGISR | |
| 683.6575 | 2047.9507 | 2047.9561 | -2.64 | 1 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
DVITGMNNWSIKFSEYK + Deamidated (NQ); Oxidation (M) | |
| 1070.8921 | 3209.6545 | 3209.6642 | -3.03 | 1 | 0 | 3.6 | 1Score > 19 indicates identity |
EASEILAGLQGILPMDISVHQVDGGLKVYR + 2 Deamidated (NQ) | |
| 695.3854 | 1388.7562 | 1388.7333 | 16.5 | 0 | 0 | 0.95 | 1Score > 21 indicates identityScore > 13 indicates homology |
MSTIGAVDILNQK | |
| 655.9687 | 1964.8843 | 1964.8938 | -4.86 | 1 | 0 | 0.95 | 1Score > 21 indicates identityScore > 13 indicates homology |
RAQYDSCDFVADVPPPK + Deamidated (NQ) | |
| 690.3262 | 1378.6378 | 1378.6398 | -1.45 | 0 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
VDAMGVESTGIQR + Deamidated (NQ); Oxidation (M) | |
| 504.7653 | 1007.5160 | 1007.5036 | 12.4 | 0 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
ILNNESYR | |
| 760.3810 | 1518.7474 | 1518.7613 | -9.10 | 1 | 0 | 1 | 1Score > 24 indicates identityScore > 13 indicates homology |
MSQKIGHSGLAFAR + Deamidated (NQ); Oxidation (M) |
Not what you expected? Try
the select summary.