MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 2 |
| MS data file | : | PRT1245_Other_P1_B10.mgf |
| Database | : | S-cerevisiae-S288C 20191206 (6,886 sequences; 3,133,934 residues) |
| Timestamp | : | 24 Jun 2025 at 21:21:38 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,780 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 1268 |
427.2304 | 852.4462 | 852.4527 | -7.62 | 1 | 5 | 1.4 | 1Score > 19 indicates identity |
KIASFCK |
| 914 |
328.1744 | 654.3342 | 654.3449 | -16.3 | 0 | 5 | 0.91 | 1Score > 17 indicates identity |
LTQHR + Deamidated (NQ) |
| 1269 |
427.2306 | 852.4466 | 852.4527 | -7.15 | 1 | 5 | 1.5 | 1Score > 19 indicates identity |
KIASFCK |
| 2854 |
685.3195 | 1368.6244 | 1368.5980 | 19.4 | 0 | 5 | 0.42 | 1Score > 21 indicates identity Score > 14 indicates homology |
AVNNTDNCYLGK + Deamidated (NQ) |
| 3328 |
852.9229 | 1703.8312 | 1703.8552 | -14.1 | 1 | 5 | 1 | 1Score > 22 indicates identity Score > 18 indicates homology |
NVSFSSLNSLMFSKK + Oxidation (M) |
| 789 |
529.2993 | 528.2920 | 528.3020 | -18.9 | 0 | 5 | 1.2 | 1Score > 18 indicates identity |
AVPSR |
| 970 |
682.3640 | 681.3567 | 681.3558 | 1.35 | 0 | 5 | 0.81 | 1Score > 21 indicates identity Score > 17 indicates homology |
GAEIHR |
| 2453 |
575.2874 | 1148.5602 | 1148.5713 | -9.63 | 0 | 5 | 0.98 | 1Score > 22 indicates identity Score > 18 indicates homology |
NLPSLEANYK + Deamidated (NQ) |
| 2585 |
589.3037 | 1176.5928 | 1176.5887 | 3.50 | 1 | 5 | 0.46 | 1Score > 23 indicates identity Score > 14 indicates homology |
QAKQLGFDDR |
| 3155 |
789.9152 | 1577.8158 | 1577.8089 | 4.38 | 0 | 5 | 1 | 1Score > 22 indicates identity Score > 18 indicates homology |
YSLPPQTIQDLFR + Deamidated (NQ) |
| 1060 |
371.7096 | 741.4046 | 741.4021 | 3.46 | 0 | 5 | 0.96 | 1Score > 17 indicates identity |
NGNVIPK + Deamidated (NQ) |
| 1771 |
996.4717 | 995.4644 | 995.4780 | -13.6 | 0 | 5 | 1 | 1Score > 21 indicates identity Score > 18 indicates homology |
ISDMIMVR + 2 Oxidation (M) |
| 1132 |
392.2042 | 782.3938 | 782.3963 | -3.12 | 0 | 5 | 1 | 1Score > 21 indicates identity Score > 18 indicates homology |
NGFFGLK + Deamidated (NQ) |
| 1584 |
474.2384 | 946.4622 | 946.4607 | 1.63 | 1 | 5 | 0.64 | 1Score > 23 indicates identity Score > 16 indicates homology |
LLNSQQKD + 2 Deamidated (NQ) |
| 2703 |
613.2924 | 1224.5702 | 1224.5907 | -16.7 | 0 | 5 | 0.56 | 1Score > 21 indicates identity Score > 15 indicates homology |
SLLLESMSSDK + Oxidation (M) |
| 1779 |
997.4586 | 996.4513 | 996.4625 | -11.2 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 18 indicates homology |
DNPPNGEVR |
| 2613 |
592.2842 | 1182.5538 | 1182.5624 | -7.25 | 1 | 5 | 1 | 1Score > 22 indicates identity Score > 18 indicates homology |
MTELKMNVGK + Deamidated (NQ); 2 Oxidation (M) |
| 1244 |
842.4384 | 841.4311 | 841.4341 | -3.52 | 1 | 5 | 1 | 1Score > 17 indicates identity |
CLHRTR |
| 2233 |
548.2568 | 1094.4990 | 1094.5026 | -3.27 | 0 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
GSTANMSLGGGK + Oxidation (M) |
| 4164 |
775.4017 | 2323.1833 | 2323.1981 | -6.37 | 0 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
TLLLMSNNNSISEIPSFSVLK + Deamidated (NQ); Oxidation (M) |
| 1225 |
836.4393 | 835.4320 | 835.4222 | 11.8 | 0 | 5 | 0.36 | 1Score > 23 indicates identity Score > 13 indicates homology |
IQTAMTR + Oxidation (M) |
| 924 |
657.3579 | 656.3506 | 656.3493 | 1.99 | 0 | 5 | 0.77 | 1Score > 16 indicates identity |
LGENPK |
| 923 |
329.1823 | 656.3500 | 656.3493 | 1.11 | 0 | 5 | 0.78 | 1Score > 16 indicates identity |
LGENPK |
| 1597 |
475.7388 | 949.4630 | 949.4651 | -2.16 | 0 | 5 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
VASSAVMNR + Oxidation (M) |
| 1200 |
820.3843 | 819.3770 | 819.3797 | -3.21 | 0 | 5 | 0.85 | 1Score > 21 indicates identity Score > 17 indicates homology |
GIDCVEK |
| 2674 |
604.3069 | 1206.5992 | 1206.6026 | -2.80 | 1 | 5 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
ILSMRNSENK + Oxidation (M) |
| 1865 |
1016.4749 | 1015.4676 | 1015.4505 | 16.8 | 0 | 5 | 1.1 | 1Score > 18 indicates identity |
NGGTDIHMR + Oxidation (M) |
| 3978 |
1083.4926 | 2164.9706 | 2164.9760 | -2.48 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
GQLDLINDGEGSLSNFADNGK + 2 Deamidated (NQ) |
| 1792 |
999.4774 | 998.4701 | 998.4781 | -8.02 | 0 | 5 | 1.6 | 1Score > 19 indicates identity |
EGVGPNVGDR |
| 2903 |
713.9066 | 1425.7986 | 1425.8191 | -14.3 | 1 | 5 | 1.2 | 1Score > 18 indicates identity |
IVALENILKEER |
| 1141 |
786.4711 | 785.4638 | 785.4759 | -15.4 | 1 | 5 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
KANLVNK |
| 1011 |
356.6844 | 711.3542 | 711.3551 | -1.24 | 0 | 5 | 1.1 | 1Score > 18 indicates identity |
DAHELK |
| 1590 |
949.4658 | 948.4585 | 948.4698 | -11.9 | 0 | 5 | 1 | 1Score > 23 indicates identity Score > 17 indicates homology |
ILDMATNR + Oxidation (M) |
| 2402 |
570.7702 | 1139.5258 | 1139.5281 | -1.97 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
MAYTSHLSSK + Oxidation (M) |
| 1652 |
483.7380 | 965.4614 | 965.4753 | -14.3 | 1 | 5 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
IATRGAFAC |
| 2024 |
525.2923 | 1048.5700 | 1048.5553 | 14.1 | 0 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
LESFNLAVR + Deamidated (NQ) |
| 4111 |
764.0587 | 2289.1543 | 2289.1207 | 14.7 | 1 | 5 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
MMNELLQKLPTCYYQTLK + Oxidation (M) |
| 3423 |
889.4370 | 1776.8594 | 1776.8564 | 1.73 | 1 | 4 | 1 | 1Score > 23 indicates identity Score > 17 indicates homology |
EQVQQVVMEGKTQEK + Deamidated (NQ); Oxidation (M) |
| 1159 |
398.2230 | 794.4314 | 794.4174 | 17.7 | 0 | 4 | 0.67 | 1Score > 21 indicates identity Score > 15 indicates homology |
VSTTYPK |
| 1069 |
744.3647 | 743.3574 | 743.3562 | 1.67 | 0 | 4 | 1.5 | 1Score > 19 indicates identity |
SGAAPNAR + Deamidated (NQ) |
| 1621 |
478.7368 | 955.4590 | 955.4685 | -9.85 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
VFNLMSTK + Deamidated (NQ); Oxidation (M) |
| 2730 |
625.3343 | 1248.6540 | 1248.6601 | -4.88 | 0 | 4 | 0.47 | 1Score > 22 indicates identity Score > 14 indicates homology |
YVSLNSEVPIK + Deamidated (NQ) |
| 2110 |
1067.5154 | 1066.5081 | 1066.5182 | -9.48 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
ISNVLDDYK + Deamidated (NQ) |
| 3655 |
661.3364 | 1980.9874 | 1980.9792 | 4.11 | 1 | 4 | 0.51 | 1Score > 22 indicates identity Score > 14 indicates homology |
NLDTFLNQLRDFLNEK + 2 Deamidated (NQ) |
| 1065 |
372.2067 | 742.3988 | 742.4086 | -13.1 | 1 | 4 | 1.2 | 1Score > 18 indicates identity |
KANPTGR |
| 1115 |
387.6912 | 773.3678 | 773.3780 | -13.1 | 0 | 4 | 1.4 | 1Score > 18 indicates identity |
GNNNLSR |
| 1702 |
980.4622 | 979.4549 | 979.4471 | 7.97 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
GNKNYNNR + Deamidated (NQ) |
| 2867 |
693.3414 | 1384.6682 | 1384.6697 | -1.03 | 0 | 4 | 0.8 | 1Score > 21 indicates identity Score > 16 indicates homology |
CFTFLNNLLDK + Deamidated (NQ) |
| 1502 |
928.4749 | 927.4676 | 927.4774 | -10.5 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
QSHAVATSK |
| 1649 |
483.7354 | 965.4562 | 965.4753 | -19.7 | 1 | 4 | 1 | 1Score > 23 indicates identity Score > 17 indicates homology |
IATRGAFAC |
| 1976 |
1039.4891 | 1038.4818 | 1038.4618 | 19.3 | 0 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
ISNEQYER + Deamidated (NQ) |
| 2186 |
542.7855 | 1083.5564 | 1083.5495 | 6.43 | 0 | 4 | 0.56 | 1Score > 20 indicates identity Score > 14 indicates homology |
IQNMANHIK + Oxidation (M) |
| 2904 |
713.9092 | 1425.8038 | 1425.8191 | -10.7 | 1 | 4 | 1.3 | 1Score > 18 indicates identity |
IVALENILKEER |
| 745 |
469.2773 | 468.2700 | 468.2696 | 0.86 | 0 | 4 | 0.37 | 1Score > 13 indicates identity |
GPAPK |
| 2045 |
1054.4805 | 1053.4732 | 1053.4839 | -10.2 | 1 | 4 | 0.67 | 1Score > 20 indicates identity Score > 15 indicates homology |
TDNQYTRR + Deamidated (NQ) |
| 3191 |
801.3995 | 1600.7844 | 1600.7620 | 14.0 | 0 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
EFPAINIPDNVNEK + 2 Deamidated (NQ) |
| 885 |
319.1872 | 636.3598 | 636.3707 | -17.1 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
QHKPK |
| 1231 |
840.4575 | 839.4502 | 839.4501 | 0.14 | 0 | 4 | 1.4 | 1Score > 18 indicates identity |
NATPVNPK |
| 2153 |
1079.5105 | 1078.5032 | 1078.4964 | 6.29 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
AEDGINKMGK + Deamidated (NQ); Oxidation (M) |
| 801 |
544.3099 | 543.3026 | 543.3017 | 1.79 | 0 | 4 | 1.1 | 1Score > 17 indicates identity |
KPDGK |
| 2696 |
611.8279 | 1221.6412 | 1221.6209 | 16.6 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
MSKVMKPSNGK + Oxidation (M) |
| 3195 |
801.9203 | 1601.8260 | 1601.8382 | -7.56 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
STVPIIIRCCIDR |
| 2914 |
717.3539 | 1432.6932 | 1432.7020 | -6.13 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
MSFNAFASSLSKK + Oxidation (M) |
| 3117 |
776.8486 | 1551.6826 | 1551.6657 | 10.9 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
NTNIGGMIAECAER + Deamidated (NQ); Oxidation (M) |
| 1781 |
997.4597 | 996.4524 | 996.4625 | -10.1 | 0 | 4 | 0.7 | 1Score > 20 indicates identity Score > 15 indicates homology |
DNPPNGEVR |
| 2026 |
525.2929 | 1048.5712 | 1048.5553 | 15.2 | 0 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
LESFNLAVR + Deamidated (NQ) |
| 1281 |
428.7306 | 855.4466 | 855.4338 | 15.0 | 0 | 4 | 1.5 | 1Score > 18 indicates identity |
TPETSPPK |
| 3543 |
627.9772 | 1880.9098 | 1880.8752 | 18.4 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
GIQGAENSGEIKGNSYEK + Deamidated (NQ) |
| 1900 |
511.7692 | 1021.5238 | 1021.5226 | 1.21 | 0 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
MAGATSSIIR + Oxidation (M) |
| 3113 |
775.3730 | 1548.7314 | 1548.7099 | 13.9 | 1 | 4 | 0.91 | 1Score > 22 indicates identity Score > 16 indicates homology |
DHIMCPTKGSMLK + 2 Oxidation (M) |
| 2412 |
571.7616 | 1141.5086 | 1141.5251 | -14.4 | 0 | 4 | 1.8 | 1Score > 19 indicates identity |
TASAPNSGNPPK + 2 Deamidated (NQ) |
| 1578 |
947.4504 | 946.4431 | 946.4443 | -1.26 | 1 | 4 | 0.47 | 1Score > 22 indicates identity Score > 13 indicates homology |
GMGFHRDK |
| 4276 |
830.0784 | 2487.2134 | 2487.1675 | 18.4 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
FVNMRTGVAGFNDSLMNHLYGK + Deamidated (NQ); Oxidation (M) |
| 1160 |
398.7013 | 795.3880 | 795.3796 | 10.6 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
MSNISTK + Oxidation (M) |
| 3473 |
913.9341 | 1825.8536 | 1825.8833 | -16.2 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
QIQYLLITNSVSNDSK + 4 Deamidated (NQ) |
| 2171 |
1081.5215 | 1080.5142 | 1080.5200 | -5.31 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
NNSKEGSAFK |
| 1270 |
853.4597 | 852.4524 | 852.4527 | -0.38 | 1 | 4 | 1.5 | 1Score > 18 indicates identity |
KIASFCK |
| 1223 |
418.2375 | 834.4604 | 834.4599 | 0.62 | 1 | 4 | 0.49 | 1Score > 21 indicates identity Score > 13 indicates homology |
KPDGKYK |
| 1545 |
939.4179 | 938.4106 | 938.4093 | 1.39 | 1 | 4 | 1.6 | 1Score > 18 indicates identity |
QNNYNKR + 3 Deamidated (NQ) |
| 2062 |
1058.4938 | 1057.4865 | 1057.4862 | 0.27 | 1 | 4 | 1.5 | 1Score > 18 indicates identity |
MYDTTQKR + Oxidation (M) |
| 1457 |
914.4493 | 913.4420 | 913.4545 | -13.7 | 0 | 4 | 1.9 | 1Score > 19 indicates identity |
GITFSFNK + Deamidated (NQ) |
| 1591 |
949.4724 | 948.4651 | 948.4698 | -4.98 | 0 | 4 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
VAAMSVAQR + Deamidated (NQ); Oxidation (M) |
| 3100 |
770.3685 | 1538.7224 | 1538.7073 | 9.84 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
RPDNQNPEGENLR + Deamidated (NQ) |
| 920 |
328.1928 | 654.3710 | 654.3701 | 1.49 | 0 | 4 | 0.58 | 1Score > 14 indicates identity |
SVPAPGK |
| 2326 |
559.7856 | 1117.5566 | 1117.5768 | -18.0 | 0 | 4 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
KPEVDLDFR |
| 1134 |
392.2218 | 782.4290 | 782.4360 | -8.93 | 1 | 4 | 1.2 | 1Score > 17 indicates identity |
KLFMTK + Oxidation (M) |
| 2831 |
674.3311 | 1346.6476 | 1346.6612 | -10.1 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
QQNIEDMLRGK + Oxidation (M) |
| 4754 |
798.7030 | 5583.8701 | 5583.7631 | 19.2 | 0 | 4 | 0.45 | 1Score > 13 indicates identity |
INLAHCAYQIIFGGMIMQLLGLGLGYFLLSHLNPDYTIYDMLESITFR + Deamidated (NQ); 3 Oxidation (M) |
| 1305 |
433.2069 | 864.3992 | 864.4130 | -15.9 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
FLDREW |
| 2695 |
610.8276 | 1219.6406 | 1219.6448 | -3.42 | 0 | 4 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
AVGNIVNEIYK + Deamidated (NQ) |
| 3282 |
834.3949 | 1666.7752 | 1666.7798 | -2.73 | 0 | 4 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
NANTPLQTLNQGHQK + 4 Deamidated (NQ) |
| 3192 |
801.9144 | 1601.8142 | 1601.8382 | -14.9 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
STVPIIIRCCIDR |
| 3567 |
954.4618 | 1906.9090 | 1906.9159 | -3.61 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
QANPYLENSIPTKNTSK + 3 Deamidated (NQ) |
| 1519 |
466.2428 | 930.4710 | 930.4658 | 5.67 | 0 | 4 | 0.67 | 1Score > 23 indicates identity Score > 14 indicates homology |
EANAGILNK + 2 Deamidated (NQ) |
| 1117 |
778.3744 | 777.3671 | 777.3691 | -2.50 | 1 | 4 | 0.86 | 1Score > 21 indicates identity Score > 15 indicates homology |
KLDNCK + Deamidated (NQ) |
| 3788 |
1035.4891 | 2068.9636 | 2068.9986 | -16.9 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
INPLNNMPELAASKQPGQK + 4 Deamidated (NQ); Oxidation (M) |
| 1358 |
442.7280 | 883.4414 | 883.4399 | 1.72 | 1 | 4 | 2.1 | 1Score > 19 indicates identity |
KDIDEHK |
| 3199 |
802.4175 | 1602.8204 | 1602.8439 | -14.7 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
ALIIGSMFHKIDDK + Oxidation (M) |
| 3554 |
947.4930 | 1892.9714 | 1892.9672 | 2.22 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
WIFESVWAGLTELTNK |
| 3656 |
991.5079 | 1981.0012 | 1980.9792 | 11.1 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
NLDTFLNQLRDFLNEK + 2 Deamidated (NQ) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/