MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1245_Other_P1_B9.mgf
Database : S-cerevisiae-S288C 20191206 (6,886 sequences; 3,133,934 residues)
Timestamp : 24 Jun 2025 at 21:21:15 GMT
Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,728

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 601–700 (out of 4700)


Page: Previous 1 2 3 4 5 6 7 8 9 10 11 12  47 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
2989 750.4153 1498.8160 1498.8395 -15.6 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
LDLINHEKYLLK + Deamidated (NQ)
1840 490.3077 978.6008 978.5936 7.42 1 1 1.1 +1Score > 13 indicates identity MLSLLFKK
2801 446.2263 1335.6571 1335.6591 -1.54 1 1 0.99 +1Score > 23 indicates identity
Score > 13 indicates homology
DLSLNKEMLEK + Deamidated (NQ); Oxidation (M)
3082 521.6017 1561.7833 1561.7997 -10.5 0 1 1 +1Score > 23 indicates identity
Score > 13 indicates homology
VLQTMSFLMNHLI + Oxidation (M)
4226 886.4378 2656.2916 2656.2473 16.7 1 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
TAISGACATTASDALMNPFDTIKQR + Deamidated (NQ); Oxidation (M)
1658 461.7556 921.4966 921.4920 5.09 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
NSFSNIIK
3231 833.8694 1665.7242 1665.6981 15.7 0 1 3.8 +1Score > 19 indicates identity QGFDNFNSYMGIEK + Deamidated (NQ); Oxidation (M)
4557 1184.5688 3550.6846 3550.6984 -3.90 1 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
GVQSPPKPPPSNEISGTIENDVESIKQAADNMAK + 3 Deamidated (NQ)
2022 514.2578 1026.5010 1026.5094 -8.17 0 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
QHATGDTGLK
2997 752.8724 1503.7302 1503.7425 -8.17 0 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
SPTGIVLMNMGGPSK + Oxidation (M)
2665 601.7909 1201.5672 1201.5761 -7.36 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
ANTPSSMHKTK + Deamidated (NQ)
4229 672.3447 2685.3497 2685.3288 7.78 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
VLYMSPTEVPLDPFDIFQFQGLK + 2 Deamidated (NQ)
3915 1083.4977 2164.9808 2164.9980 -7.92 1 1 1 +1Score > 20 indicates identity
Score > 13 indicates homology
ADMARLQLTSPACTEINEK + 2 Deamidated (NQ); Oxidation (M)
4071 775.7153 2324.1241 2324.1610 -15.9 0 1 1 +1Score > 21 indicates identity
Score > 13 indicates homology
TVAGFSNVELPQCIIPSSYIK + 2 Deamidated (NQ)
2102 524.7633 1047.5120 1047.5026 9.05 0 1 1 +1Score > 22 indicates identity
Score > 13 indicates homology
GPFNWTVEV
3254 842.4398 1682.8650 1682.8951 -17.9 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
ISIIEENSPERQIR
3611 663.6769 1988.0089 1987.9972 5.88 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
QMTRASFLGTFLSTCIR
4159 830.0793 2487.2161 2487.1675 19.5 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
FVNMRTGVAGFNDSLMNHLYGK + Deamidated (NQ); Oxidation (M)
4458 1032.4622 3094.3648 3094.3614 1.09 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
EKIENYQYDLWGDSTETNDHVMHLR + 2 Deamidated (NQ)
1327 778.3637 777.3564 777.3552 1.62 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
GQGGMRR + Deamidated (NQ); Oxidation (M)
4553 1183.5658 3547.6756 3547.6626 3.66 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
NFLTDPLMASDCQSYVTFPEVSKISNLPLNK + 4 Deamidated (NQ); Oxidation (M)
1440 835.4360 834.4287 834.4235 6.22 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
NIENFAK
3030 762.3206 1522.6266 1522.6536 -17.7 1 0 1.7 +1Score > 15 indicates identity RQDDDDDLLFNR + 2 Deamidated (NQ)
1309 767.3697 766.3624 766.3497 16.6 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
GDAETFK
4336 952.4565 2854.3477 2854.3073 14.2 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
MSGVNNTSANELSTTMSNSNSAVGAPSVK
4045 1152.5609 2303.1072 2303.0779 12.7 1 0 0.98 +1Score > 22 indicates identity
Score > 13 indicates homology
ENFLKCFSQYIPNNATNLK + 3 Deamidated (NQ)
2825 457.9066 1370.6980 1370.7081 -7.42 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
AAYSLFITNKDK + Deamidated (NQ)
2804 669.3487 1336.6828 1336.6883 -4.07 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
FLKPMMATASPK + Oxidation (M)
2809 672.8285 1343.6424 1343.6510 -6.35 0 0 0.96 +1Score > 21 indicates identity
Score > 13 indicates homology
DGEWLYHISPK
2863 702.3655 1402.7164 1402.6940 16.0 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
LNQISNDTQVIR + 3 Deamidated (NQ)
3193 817.9067 1633.7988 1633.8159 -10.4 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
TQQDDSNITTILKR + 2 Deamidated (NQ)
4039 1151.5573 2301.1000 2301.0583 18.1 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
DGDILQLGMDFRGGTEEIYR + Deamidated (NQ); Oxidation (M)
4134 810.7036 2429.0890 2429.1268 -15.6 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
KTLDDSEGFSQDMLISSSNLNK + Deamidated (NQ)
2487 1149.5450 1148.5377 1148.5561 -16.0 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
DNSVGKILNST + 2 Deamidated (NQ)
2472 573.3210 1144.6274 1144.6088 16.3 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
IKTANSATGGPK + Deamidated (NQ)
2558 1164.6124 1163.6051 1163.5935 10.0 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
KFVIDSNQGR + Deamidated (NQ)
3434 612.9583 1835.8531 1835.8286 13.3 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
GRVNDSTADFNSEGLPR + 2 Deamidated (NQ)
4679 931.4851 5582.8669 5582.9224 -9.93 1 0 1.1 +1Score > 13 indicates identity FLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYR + 3 Deamidated (NQ); 2 Oxidation (M)
1806 483.7391 965.4636 965.4753 -12.0 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology
IATRGAFAC
2675 605.8099 1209.6052 1209.5812 19.9 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
QGNVKQFMNK + Deamidated (NQ); Oxidation (M)
3741 1030.9244 2059.8342 2059.8689 -16.8 1 0 1.7 +1Score > 15 indicates identity MNQKIMEFPSHSMYNGK + 3 Deamidated (NQ); Oxidation (M)
3120 794.9098 1587.8050 1587.8256 -13.0 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology
AAQNPLADIQVYKR + 2 Deamidated (NQ)
3845 1058.5344 2115.0542 2115.0371 8.09 1 0 1 +1Score > 23 indicates identity
Score > 13 indicates homology
EEEEALVEGLKEVGPSWSK
4597 1016.7766 4063.0773 4063.0475 7.34 0 0 2.7 +1Score > 17 indicates identity SLQGLQNQMLSIFMYTVIFNPILQQYLPSFVQQR + 3 Deamidated (NQ); Oxidation (M)
1352 786.4823 785.4750 785.4759 -1.16 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
VVINSVR
1194 696.3326 695.3253 695.3126 18.3 0 0 4.5 +1Score > 19 indicates identity QQYEK + Deamidated (NQ)
3192 817.8984 1633.7822 1633.7981 -9.72 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
GDVDLMVESEKLGAR + Oxidation (M)
4172 839.4235 2515.2487 2515.2657 -6.78 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
CTITPFLHVCWFVSLHKWGK
2722 629.8093 1257.6040 1257.6088 -3.81 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
DQLELNPDVSK + Deamidated (NQ)
4307 937.1121 2808.3145 2808.3440 -10.5 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
NISTILESTLAYLQTIPDDANNEAAK + 4 Deamidated (NQ)
1705 935.5045 934.4972 934.5124 -16.2 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
ALQVVYNK + Deamidated (NQ)
2322 1106.5140 1105.5067 1105.5251 -16.6 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
SNSDLEKQGK + Deamidated (NQ)
3476 936.4362 1870.8578 1870.8657 -4.20 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
ISDILDSGSGNGTIHDDR
3968 1109.0143 2216.0140 2216.0015 5.64 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
SRPNTPGSDTSNDLPAECVIS
4147 822.7712 2465.2918 2465.2916 0.065 1 0 4.8 +1Score > 20 indicates identity VWKMFVDVFNTLPLAAIIQDK + 2 Deamidated (NQ); Oxidation (M)
1585 448.7292 895.4438 895.4262 19.7 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
MKWNFGI + Deamidated (NQ)
3028 761.4072 1520.7998 1520.8272 -18.0 0 0 0.98 +1Score > 22 indicates identity
Score > 13 indicates homology
LDIIQVMLYLER + Oxidation (M)
3615 664.0107 1989.0103 1989.0306 -10.2 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
QIVQIEQAPKDYISDIK + 2 Deamidated (NQ)
2453 571.3064 1140.5982 1140.6139 -13.7 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
KETLESLHGK
4091 1175.5613 2349.1080 2349.0801 11.9 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
NPESFNSFQIDQKVFNYLR + 4 Deamidated (NQ)
1546 440.2381 878.4616 878.4531 9.69 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
ETLMKGGK + Oxidation (M)
2987 750.3889 1498.7632 1498.7391 16.1 0 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
FMPHFPSSPSPLR
3043 766.8662 1531.7178 1531.7208 -1.92 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
EYPNFRFGPSYR
3076 778.3519 1554.6892 1554.6797 6.11 0 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
QIQQQQQQQQHK + 6 Deamidated (NQ)
4641 752.1891 4507.0909 4507.1186 -6.13 0 0 4.4 +1Score > 19 indicates identity LTADDMQGGTFTVNNTGSFGSVQSMGIINYPQAAILQVESIVK + 6 Deamidated (NQ)
1388 810.3645 809.3572 809.3555 2.11 0 0 3.6 +1Score > 18 indicates identity EGANYQK + Deamidated (NQ)
1543 440.2342 878.4538 878.4498 4.64 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
ENLTFQK
1286 754.3365 753.3292 753.3268 3.18 0 0 2.4 +1Score > 16 indicates identity NWFCK
1649 919.5031 918.4958 918.4844 12.4 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
TMDPIAKK + Oxidation (M)
2237 1084.4927 1083.4854 1083.4767 8.01 0 0 4.7 +1Score > 19 indicates identity YNTNGTCVR
1140 669.3264 668.3191 668.3129 9.25 0 0 4.1 +1Score > 19 indicates identity SASGYGK
2700 612.8607 1223.7068 1223.7237 -13.8 1 0 2.6 +1Score > 17 indicates identity LIQLKNLPQR + 2 Deamidated (NQ)
3339 873.4383 1744.8620 1744.8566 3.11 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
EVYDPSHNMIQKLR + Oxidation (M)
2584 585.8069 1169.5992 1169.6081 -7.54 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
PPKFDPNEVK
3364 881.4230 1760.8314 1760.8250 3.65 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
EANQDLKPCQEKTAK + 2 Deamidated (NQ)
4727 1152.2206 6907.2799 6907.1683 16.2 0 0 1.2 +1Score > 13 indicates identity AQELQQIPTQNSAASSYQQQPFPPPSTNYYQQPQQQPQQAPPPQQQQQQQQHQSSHSHLK + 6 Deamidated (NQ)
1237 361.7019 721.3892 721.3759 18.5 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
ALSQFR + Deamidated (NQ)
1755 951.4246 950.4173 950.4127 4.84 0 0 3.5 +1Score > 18 indicates identity GINGMSNNK + Deamidated (NQ); Oxidation (M)
3937 731.3778 2191.1116 2191.1008 4.91 0 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
SIILNEEANLNDVFVGSTVR + 2 Deamidated (NQ)
2251 545.2576 1088.5006 1088.5172 -15.2 0 0 4.7 +1Score > 19 indicates identity QMQETLDPK
3622 664.6434 1990.9084 1990.8902 9.14 1 0 1 +1Score > 21 indicates identity
Score > 13 indicates homology
KQLAQDQMSTTGSNSAGHK + 3 Deamidated (NQ)
3728 686.3442 2056.0108 2055.9929 8.71 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
ITRTNSGCSITSGASMIATK + Deamidated (NQ)
2133 527.7443 1053.4740 1053.4839 -9.37 1 0 1 +1Score > 20 indicates identity
Score > 13 indicates homology
TDNQYTRR + Deamidated (NQ)
3378 887.4537 1772.8928 1772.8615 17.7 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
KICSGSTTISESQTFK
3730 1029.4885 2056.9624 2056.9371 12.3 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
SMTPFSAGNTSSQNKLENK + Deamidated (NQ); Oxidation (M)
4428 752.1233 3004.4641 3004.4528 3.76 1 0 1 +1Score > 22 indicates identity
Score > 13 indicates homology
DLQPKVYFMYYGESIEEQSHLTAIK + Oxidation (M)
1 300.0932 299.0859
2 300.2090 299.2017
3 301.1166 300.1093
4 301.1428 300.1355
5 301.1435 300.1362
6 301.1436 300.1363
7 301.1436 300.1363
8 301.1436 300.1363
9 301.1437 300.1364
10 301.1438 300.1365
11 301.1440 300.1367
12 301.1441 300.1368
13 301.1444 300.1371
14 301.1444 300.1371
Page: Previous 1 2 3 4 5 6 7 8 9 10 11 12  47 Next 

Not what you expected? Try the select summary.