| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 1 |
| MS data file | : | PRT1245_Other_P1_B9.mgf |
| Database | : | S-cerevisiae-S288C 20191206 (6,886 sequences; 3,133,934 residues) |
| Timestamp | : | 24 Jun 2025 at 21:21:15 GMT |
Not what you expected? Try
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | |
| Variable modifications | : | |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,728 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 | 2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | ||||
| 6.2e-007 | 1 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | ||||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle (
) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 750.4153 | 1498.8160 | 1498.8395 | -15.6 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
LDLINHEKYLLK + Deamidated (NQ) | |
| 490.3077 | 978.6008 | 978.5936 | 7.42 | 1 | 1 | 1.1 | 1Score > 13 indicates identity |
MLSLLFKK | |
| 446.2263 | 1335.6571 | 1335.6591 | -1.54 | 1 | 1 | 0.99 | 1Score > 23 indicates identityScore > 13 indicates homology |
DLSLNKEMLEK + Deamidated (NQ); Oxidation (M) | |
| 521.6017 | 1561.7833 | 1561.7997 | -10.5 | 0 | 1 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
VLQTMSFLMNHLI + Oxidation (M) | |
| 886.4378 | 2656.2916 | 2656.2473 | 16.7 | 1 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
TAISGACATTASDALMNPFDTIKQR + Deamidated (NQ); Oxidation (M) | |
| 461.7556 | 921.4966 | 921.4920 | 5.09 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
NSFSNIIK | |
| 833.8694 | 1665.7242 | 1665.6981 | 15.7 | 0 | 1 | 3.8 | 1Score > 19 indicates identity |
QGFDNFNSYMGIEK + Deamidated (NQ); Oxidation (M) | |
| 1184.5688 | 3550.6846 | 3550.6984 | -3.90 | 1 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
GVQSPPKPPPSNEISGTIENDVESIKQAADNMAK + 3 Deamidated (NQ) | |
| 514.2578 | 1026.5010 | 1026.5094 | -8.17 | 0 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
QHATGDTGLK | |
| 752.8724 | 1503.7302 | 1503.7425 | -8.17 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
SPTGIVLMNMGGPSK + Oxidation (M) | |
| 601.7909 | 1201.5672 | 1201.5761 | -7.36 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
ANTPSSMHKTK + Deamidated (NQ) | |
| 672.3447 | 2685.3497 | 2685.3288 | 7.78 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
VLYMSPTEVPLDPFDIFQFQGLK + 2 Deamidated (NQ) | |
| 1083.4977 | 2164.9808 | 2164.9980 | -7.92 | 1 | 1 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
ADMARLQLTSPACTEINEK + 2 Deamidated (NQ); Oxidation (M) | |
| 775.7153 | 2324.1241 | 2324.1610 | -15.9 | 0 | 1 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
TVAGFSNVELPQCIIPSSYIK + 2 Deamidated (NQ) | |
| 524.7633 | 1047.5120 | 1047.5026 | 9.05 | 0 | 1 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
GPFNWTVEV | |
| 842.4398 | 1682.8650 | 1682.8951 | -17.9 | 1 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
ISIIEENSPERQIR | |
| 663.6769 | 1988.0089 | 1987.9972 | 5.88 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
QMTRASFLGTFLSTCIR | |
| 830.0793 | 2487.2161 | 2487.1675 | 19.5 | 1 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
FVNMRTGVAGFNDSLMNHLYGK + Deamidated (NQ); Oxidation (M) | |
| 1032.4622 | 3094.3648 | 3094.3614 | 1.09 | 1 | 0 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
EKIENYQYDLWGDSTETNDHVMHLR + 2 Deamidated (NQ) | |
| 778.3637 | 777.3564 | 777.3552 | 1.62 | 1 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
GQGGMRR + Deamidated (NQ); Oxidation (M) | |
| 1183.5658 | 3547.6756 | 3547.6626 | 3.66 | 1 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
NFLTDPLMASDCQSYVTFPEVSKISNLPLNK + 4 Deamidated (NQ); Oxidation (M) | |
| 835.4360 | 834.4287 | 834.4235 | 6.22 | 0 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
NIENFAK | |
| 762.3206 | 1522.6266 | 1522.6536 | -17.7 | 1 | 0 | 1.7 | 1Score > 15 indicates identity |
RQDDDDDLLFNR + 2 Deamidated (NQ) | |
| 767.3697 | 766.3624 | 766.3497 | 16.6 | 0 | 0 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
GDAETFK | |
| 952.4565 | 2854.3477 | 2854.3073 | 14.2 | 0 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
MSGVNNTSANELSTTMSNSNSAVGAPSVK | |
| 1152.5609 | 2303.1072 | 2303.0779 | 12.7 | 1 | 0 | 0.98 | 1Score > 22 indicates identityScore > 13 indicates homology |
ENFLKCFSQYIPNNATNLK + 3 Deamidated (NQ) | |
| 457.9066 | 1370.6980 | 1370.7081 | -7.42 | 1 | 0 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
AAYSLFITNKDK + Deamidated (NQ) | |
| 669.3487 | 1336.6828 | 1336.6883 | -4.07 | 0 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
FLKPMMATASPK + Oxidation (M) | |
| 672.8285 | 1343.6424 | 1343.6510 | -6.35 | 0 | 0 | 0.96 | 1Score > 21 indicates identityScore > 13 indicates homology |
DGEWLYHISPK | |
| 702.3655 | 1402.7164 | 1402.6940 | 16.0 | 0 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
LNQISNDTQVIR + 3 Deamidated (NQ) | |
| 817.9067 | 1633.7988 | 1633.8159 | -10.4 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
TQQDDSNITTILKR + 2 Deamidated (NQ) | |
| 1151.5573 | 2301.1000 | 2301.0583 | 18.1 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
DGDILQLGMDFRGGTEEIYR + Deamidated (NQ); Oxidation (M) | |
| 810.7036 | 2429.0890 | 2429.1268 | -15.6 | 1 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
KTLDDSEGFSQDMLISSSNLNK + Deamidated (NQ) | |
| 1149.5450 | 1148.5377 | 1148.5561 | -16.0 | 1 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
DNSVGKILNST + 2 Deamidated (NQ) | |
| 573.3210 | 1144.6274 | 1144.6088 | 16.3 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
IKTANSATGGPK + Deamidated (NQ) | |
| 1164.6124 | 1163.6051 | 1163.5935 | 10.0 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
KFVIDSNQGR + Deamidated (NQ) | |
| 612.9583 | 1835.8531 | 1835.8286 | 13.3 | 1 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
GRVNDSTADFNSEGLPR + 2 Deamidated (NQ) | |
| 931.4851 | 5582.8669 | 5582.9224 | -9.93 | 1 | 0 | 1.1 | 1Score > 13 indicates identity |
FLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYR + 3 Deamidated (NQ); 2 Oxidation (M) | |
| 483.7391 | 965.4636 | 965.4753 | -12.0 | 1 | 0 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
IATRGAFAC | |
| 605.8099 | 1209.6052 | 1209.5812 | 19.9 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
QGNVKQFMNK + Deamidated (NQ); Oxidation (M) | |
| 1030.9244 | 2059.8342 | 2059.8689 | -16.8 | 1 | 0 | 1.7 | 1Score > 15 indicates identity |
MNQKIMEFPSHSMYNGK + 3 Deamidated (NQ); Oxidation (M) | |
| 794.9098 | 1587.8050 | 1587.8256 | -13.0 | 1 | 0 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
AAQNPLADIQVYKR + 2 Deamidated (NQ) | |
| 1058.5344 | 2115.0542 | 2115.0371 | 8.09 | 1 | 0 | 1 | 1Score > 23 indicates identityScore > 13 indicates homology |
EEEEALVEGLKEVGPSWSK | |
| 1016.7766 | 4063.0773 | 4063.0475 | 7.34 | 0 | 0 | 2.7 | 1Score > 17 indicates identity |
SLQGLQNQMLSIFMYTVIFNPILQQYLPSFVQQR + 3 Deamidated (NQ); Oxidation (M) | |
| 786.4823 | 785.4750 | 785.4759 | -1.16 | 0 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
VVINSVR | |
| 696.3326 | 695.3253 | 695.3126 | 18.3 | 0 | 0 | 4.5 | 1Score > 19 indicates identity |
QQYEK + Deamidated (NQ) | |
| 817.8984 | 1633.7822 | 1633.7981 | -9.72 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
GDVDLMVESEKLGAR + Oxidation (M) | |
| 839.4235 | 2515.2487 | 2515.2657 | -6.78 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
CTITPFLHVCWFVSLHKWGK | |
| 629.8093 | 1257.6040 | 1257.6088 | -3.81 | 0 | 0 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
DQLELNPDVSK + Deamidated (NQ) | |
| 937.1121 | 2808.3145 | 2808.3440 | -10.5 | 0 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
NISTILESTLAYLQTIPDDANNEAAK + 4 Deamidated (NQ) | |
| 935.5045 | 934.4972 | 934.5124 | -16.2 | 0 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
ALQVVYNK + Deamidated (NQ) | |
| 1106.5140 | 1105.5067 | 1105.5251 | -16.6 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
SNSDLEKQGK + Deamidated (NQ) | |
| 936.4362 | 1870.8578 | 1870.8657 | -4.20 | 0 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
ISDILDSGSGNGTIHDDR | |
| 1109.0143 | 2216.0140 | 2216.0015 | 5.64 | 0 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
SRPNTPGSDTSNDLPAECVIS | |
| 822.7712 | 2465.2918 | 2465.2916 | 0.065 | 1 | 0 | 4.8 | 1Score > 20 indicates identity |
VWKMFVDVFNTLPLAAIIQDK + 2 Deamidated (NQ); Oxidation (M) | |
| 448.7292 | 895.4438 | 895.4262 | 19.7 | 1 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
MKWNFGI + Deamidated (NQ) | |
| 761.4072 | 1520.7998 | 1520.8272 | -18.0 | 0 | 0 | 0.98 | 1Score > 22 indicates identityScore > 13 indicates homology |
LDIIQVMLYLER + Oxidation (M) | |
| 664.0107 | 1989.0103 | 1989.0306 | -10.2 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
QIVQIEQAPKDYISDIK + 2 Deamidated (NQ) | |
| 571.3064 | 1140.5982 | 1140.6139 | -13.7 | 1 | 0 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
KETLESLHGK | |
| 1175.5613 | 2349.1080 | 2349.0801 | 11.9 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
NPESFNSFQIDQKVFNYLR + 4 Deamidated (NQ) | |
| 440.2381 | 878.4616 | 878.4531 | 9.69 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
ETLMKGGK + Oxidation (M) | |
| 750.3889 | 1498.7632 | 1498.7391 | 16.1 | 0 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
FMPHFPSSPSPLR | |
| 766.8662 | 1531.7178 | 1531.7208 | -1.92 | 1 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
EYPNFRFGPSYR | |
| 778.3519 | 1554.6892 | 1554.6797 | 6.11 | 0 | 0 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
QIQQQQQQQQHK + 6 Deamidated (NQ) | |
| 752.1891 | 4507.0909 | 4507.1186 | -6.13 | 0 | 0 | 4.4 | 1Score > 19 indicates identity |
LTADDMQGGTFTVNNTGSFGSVQSMGIINYPQAAILQVESIVK + 6 Deamidated (NQ) | |
| 810.3645 | 809.3572 | 809.3555 | 2.11 | 0 | 0 | 3.6 | 1Score > 18 indicates identity |
EGANYQK + Deamidated (NQ) | |
| 440.2342 | 878.4538 | 878.4498 | 4.64 | 0 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
ENLTFQK | |
| 754.3365 | 753.3292 | 753.3268 | 3.18 | 0 | 0 | 2.4 | 1Score > 16 indicates identity |
NWFCK | |
| 919.5031 | 918.4958 | 918.4844 | 12.4 | 1 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
TMDPIAKK + Oxidation (M) | |
| 1084.4927 | 1083.4854 | 1083.4767 | 8.01 | 0 | 0 | 4.7 | 1Score > 19 indicates identity |
YNTNGTCVR | |
| 669.3264 | 668.3191 | 668.3129 | 9.25 | 0 | 0 | 4.1 | 1Score > 19 indicates identity |
SASGYGK | |
| 612.8607 | 1223.7068 | 1223.7237 | -13.8 | 1 | 0 | 2.6 | 1Score > 17 indicates identity |
LIQLKNLPQR + 2 Deamidated (NQ) | |
| 873.4383 | 1744.8620 | 1744.8566 | 3.11 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
EVYDPSHNMIQKLR + Oxidation (M) | |
| 585.8069 | 1169.5992 | 1169.6081 | -7.54 | 1 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
PPKFDPNEVK | |
| 881.4230 | 1760.8314 | 1760.8250 | 3.65 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
EANQDLKPCQEKTAK + 2 Deamidated (NQ) | |
| 1152.2206 | 6907.2799 | 6907.1683 | 16.2 | 0 | 0 | 1.2 | 1Score > 13 indicates identity |
AQELQQIPTQNSAASSYQQQPFPPPSTNYYQQPQQQPQQAPPPQQQQQQQQHQSSHSHLK + 6 Deamidated (NQ) | |
| 361.7019 | 721.3892 | 721.3759 | 18.5 | 0 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
ALSQFR + Deamidated (NQ) | |
| 951.4246 | 950.4173 | 950.4127 | 4.84 | 0 | 0 | 3.5 | 1Score > 18 indicates identity |
GINGMSNNK + Deamidated (NQ); Oxidation (M) | |
| 731.3778 | 2191.1116 | 2191.1008 | 4.91 | 0 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
SIILNEEANLNDVFVGSTVR + 2 Deamidated (NQ) | |
| 545.2576 | 1088.5006 | 1088.5172 | -15.2 | 0 | 0 | 4.7 | 1Score > 19 indicates identity |
QMQETLDPK | |
| 664.6434 | 1990.9084 | 1990.8902 | 9.14 | 1 | 0 | 1 | 1Score > 21 indicates identityScore > 13 indicates homology |
KQLAQDQMSTTGSNSAGHK + 3 Deamidated (NQ) | |
| 686.3442 | 2056.0108 | 2055.9929 | 8.71 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
ITRTNSGCSITSGASMIATK + Deamidated (NQ) | |
| 527.7443 | 1053.4740 | 1053.4839 | -9.37 | 1 | 0 | 1 | 1Score > 20 indicates identityScore > 13 indicates homology |
TDNQYTRR + Deamidated (NQ) | |
| 887.4537 | 1772.8928 | 1772.8615 | 17.7 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
KICSGSTTISESQTFK | |
| 1029.4885 | 2056.9624 | 2056.9371 | 12.3 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
SMTPFSAGNTSSQNKLENK + Deamidated (NQ); Oxidation (M) | |
| 752.1233 | 3004.4641 | 3004.4528 | 3.76 | 1 | 0 | 1 | 1Score > 22 indicates identityScore > 13 indicates homology |
DLQPKVYFMYYGESIEEQSHLTAIK + Oxidation (M) | |
| 300.0932 | 299.0859 | ||||||||
| 300.2090 | 299.2017 | ||||||||
| 301.1166 | 300.1093 | ||||||||
| 301.1428 | 300.1355 | ||||||||
| 301.1435 | 300.1362 | ||||||||
| 301.1436 | 300.1363 | ||||||||
| 301.1436 | 300.1363 | ||||||||
| 301.1436 | 300.1363 | ||||||||
| 301.1437 | 300.1364 | ||||||||
| 301.1438 | 300.1365 | ||||||||
| 301.1440 | 300.1367 | ||||||||
| 301.1441 | 300.1368 | ||||||||
| 301.1444 | 300.1371 | ||||||||
| 301.1444 | 300.1371 | ||||||||
Not what you expected? Try
the select summary.