MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 1 |
| MS data file | : | PRT1245_Other_P1_B9.mgf |
| Database | : | S-cerevisiae-S288C 20191206 (6,886 sequences; 3,133,934 residues) |
| Timestamp | : | 24 Jun 2025 at 21:21:15 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,728 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 4221 |
883.1387 | 2646.3943 | 2646.4317 | -14.2 | 0 | 1 | 3.4 | 1Score > 19 indicates identity |
VVMAIVWYAVQAWLGATPVALMLK + Deamidated (NQ); Oxidation (M) |
| 1360 |
397.6882 | 793.3618 | 793.3640 | -2.71 | 0 | 1 | 0.99 | 1Score > 21 indicates identity Score > 14 indicates homology |
MAISDGGK + Oxidation (M) |
| 2714 |
621.3268 | 1240.6390 | 1240.6550 | -12.9 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
ALPNIENDIIK + 2 Deamidated (NQ) |
| 2775 |
657.8084 | 1313.6022 | 1313.6186 | -12.5 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
FRMNFEQGLR + Deamidated (NQ); Oxidation (M) |
| 3665 |
1005.4990 | 2008.9834 | 2008.9751 | 4.18 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
VAPTKPMYCASFQLPANV + Oxidation (M) |
| 2173 |
533.2672 | 1064.5198 | 1064.5390 | -17.9 | 0 | 1 | 1 | 1Score > 23 indicates identity Score > 14 indicates homology |
QITYNSIPK + 2 Deamidated (NQ) |
| 2960 |
740.3579 | 1478.7012 | 1478.7286 | -18.5 | 1 | 1 | 0.84 | 1Score > 22 indicates identity Score > 13 indicates homology |
TSMSIIDDENVKK |
| 2666 |
601.7927 | 1201.5708 | 1201.5761 | -4.37 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
ANTPSSMHKTK + Deamidated (NQ) |
| 2762 |
649.8251 | 1297.6356 | 1297.6302 | 4.18 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
ANNSLNNFKFK + 2 Deamidated (NQ) |
| 3358 |
879.9225 | 1757.8304 | 1757.8328 | -1.32 | 1 | 1 | 0.86 | 1Score > 22 indicates identity Score > 13 indicates homology |
MQLQGEMSASAAKVYK + Deamidated (NQ); Oxidation (M) |
| 1502 |
860.4210 | 859.4137 | 859.4188 | -5.90 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
WADEALR |
| 3221 |
552.9156 | 1655.7250 | 1655.7065 | 11.1 | 1 | 1 | 3.3 | 1Score > 19 indicates identity |
RNVANTTNMNMNLM + Deamidated (NQ); 2 Oxidation (M) |
| 1501 |
859.4873 | 858.4800 | 858.4811 | -1.21 | 1 | 1 | 1 | 1Score > 23 indicates identity Score > 14 indicates homology |
VDQELKK |
| 1601 |
903.5104 | 902.5031 | 902.5073 | -4.60 | 1 | 1 | 0.89 | 1Score > 22 indicates identity Score > 13 indicates homology |
GELETKVK |
| 2656 |
1195.5641 | 1194.5568 | 1194.5373 | 16.4 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
QVSASMGQVCK + Deamidated (NQ) |
| 1853 |
982.5602 | 981.5529 | 981.5607 | -7.94 | 0 | 1 | 2.5 | 1Score > 18 indicates identity |
LLGAQPDIR |
| 2657 |
598.3218 | 1194.6290 | 1194.6357 | -5.54 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
LQDAIVDHKR + Deamidated (NQ) |
| 3632 |
998.4750 | 1994.9354 | 1994.9619 | -13.3 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
GIVDIYSNDVMIIDNNGK + Oxidation (M) |
| 1384 |
403.2285 | 804.4424 | 804.4341 | 10.4 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
TISDKNK |
| 3040 |
765.9080 | 1529.8014 | 1529.7937 | 5.06 | 0 | 1 | 0.96 | 1Score > 23 indicates identity Score > 13 indicates homology |
ENQVVVIIGETGSGK + Deamidated (NQ) |
| 3911 |
721.7194 | 2162.1364 | 2162.1041 | 14.9 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
DLDAPRPPLPQPMKQEVSK + Deamidated (NQ); Oxidation (M) |
| 4216 |
873.4280 | 2617.2622 | 2617.2217 | 15.5 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
LSNVNISMNQENINNDTFLYKK + 3 Deamidated (NQ); Oxidation (M) |
| 3094 |
785.8840 | 1569.7534 | 1569.7634 | -6.37 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
KPEVVENEDVQQR + Deamidated (NQ) |
| 4078 |
777.3752 | 2329.1038 | 2329.1260 | -9.53 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
MSDNLLSLENPVVPSHYELR + Deamidated (NQ); Oxidation (M) |
| 2087 |
1045.5029 | 1044.4956 | 1044.5087 | -12.5 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 14 indicates homology |
KDGEENKPK + Deamidated (NQ) |
| 3111 |
792.8883 | 1583.7620 | 1583.7903 | -17.9 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 14 indicates homology |
NLGDAVPEVRDATAR + Deamidated (NQ) |
| 2948 |
733.3454 | 1464.6762 | 1464.6919 | -10.7 | 1 | 1 | 0.87 | 1Score > 21 indicates identity Score > 13 indicates homology |
ILDLDPRTEAYC |
| 3084 |
781.9004 | 1561.7862 | 1561.8100 | -15.2 | 1 | 1 | 0.97 | 1Score > 23 indicates identity Score > 13 indicates homology |
DINDININFAAKSK |
| 1377 |
802.3975 | 801.3902 | 801.3994 | -11.4 | 1 | 1 | 3.6 | 1Score > 19 indicates identity |
HYGNRR |
| 1998 |
511.7451 | 1021.4756 | 1021.4577 | 17.6 | 1 | 1 | 0.94 | 1Score > 22 indicates identity Score > 13 indicates homology |
RGSGPYDDR |
| 3872 |
712.3509 | 2134.0309 | 2134.0523 | -10.1 | 1 | 1 | 1 | 1Score > 23 indicates identity Score > 14 indicates homology |
WGPAAAIEFEYDPWNKLK |
| 3679 |
1011.4586 | 2020.9026 | 2020.9082 | -2.73 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 14 indicates homology |
LNPDGTMAIDEETMVVDR + Oxidation (M) |
| 4343 |
956.4891 | 2866.4455 | 2866.4521 | -2.31 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
SNGMLDLLLQSDGSLIYSLNISQLLR + 4 Deamidated (NQ) |
| 4681 |
1118.5420 | 5587.6736 | 5587.6592 | 2.59 | 1 | 1 | 2 | 1Score > 17 indicates identity |
NLSETSSEFGFPNLIGFPTSIWDESLYKAWSQIVCSLIPNMSNHQSNLK + 2 Deamidated (NQ) |
| 2660 |
600.3022 | 1198.5898 | 1198.5838 | 5.02 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
MGQLLYSMTR |
| 3854 |
707.9954 | 2120.9644 | 2120.9902 | -12.2 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
ANYGKNASIEYPPNPDELK + 2 Deamidated (NQ) |
| 1999 |
1022.4968 | 1021.4895 | 1021.4941 | -4.46 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
YGQNDRLR + Deamidated (NQ) |
| 4349 |
961.4862 | 2881.4368 | 2881.4167 | 6.95 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
GLIIQFIDQAQTTFAQMQRQLDGEK + 3 Deamidated (NQ) |
| 3180 |
407.9470 | 1627.7589 | 1627.7399 | 11.6 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
TQGYTVADCTAEAIK + Deamidated (NQ) |
| 1851 |
491.7278 | 981.4410 | 981.4226 | 18.8 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
QGNEQMFK + Deamidated (NQ) |
| 1436 |
833.4109 | 832.4036 | 832.4151 | -13.8 | 1 | 1 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
NRTGTQR + Deamidated (NQ) |
| 3138 |
400.9388 | 1599.7261 | 1599.7488 | -14.2 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
NNVSQNINQSLPNR + 3 Deamidated (NQ) |
| 4122 |
599.8105 | 2395.2129 | 2395.1695 | 18.1 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
SINEVFRFQQLLVHEYNEK + 3 Deamidated (NQ) |
| 892 |
472.2443 | 471.2370 | 471.2441 | -15.1 | 0 | 1 | 1.5 | 1Score > 15 indicates identity |
GNPGK |
| 1588 |
898.3903 | 897.3830 | 897.3716 | 12.8 | 0 | 1 | 2.4 | 1Score > 17 indicates identity |
ADSGYEEK |
| 2117 |
525.2931 | 1048.5716 | 1048.5553 | 15.6 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
LESFNLAVR + Deamidated (NQ) |
| 2740 |
636.3233 | 1270.6320 | 1270.6452 | -10.3 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
ALANTRPMEPR + Oxidation (M) |
| 2883 |
714.8177 | 1427.6208 | 1427.6385 | -12.3 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
MSVQESITQSMR + 2 Oxidation (M) |
| 4043 |
768.3829 | 2302.1269 | 2302.1515 | -10.7 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
LSMESPHVNVFSILTDLDIR + Deamidated (NQ); Oxidation (M) |
| 3270 |
847.3845 | 1692.7544 | 1692.7817 | -16.1 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
DTYMLLFGNQAYNK + Oxidation (M) |
| 1155 |
678.3231 | 677.3158 | 677.3166 | -1.20 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
NEMIR + Oxidation (M) |
| 1828 |
488.2698 | 974.5250 | 974.5298 | -4.83 | 1 | 1 | 0.89 | 1Score > 22 indicates identity Score > 13 indicates homology |
RDVVYPAR |
| 2083 |
1043.5104 | 1042.5031 | 1042.5005 | 2.53 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
GITTETMYK |
| 1361 |
795.4126 | 794.4053 | 794.4188 | -16.9 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
GLFHGHK |
| 3119 |
794.9091 | 1587.8036 | 1587.8256 | -13.8 | 1 | 1 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
AAQNPLADIQVYKR + 2 Deamidated (NQ) |
| 4044 |
768.3962 | 2302.1668 | 2302.1993 | -14.1 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
VALILFMQAIFAFENMGLIK + 2 Deamidated (NQ); 2 Oxidation (M) |
| 2940 |
730.3890 | 1458.7634 | 1458.7905 | -18.5 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
MTVVVLEKNPWK + Oxidation (M) |
| 3006 |
754.9100 | 1507.8054 | 1507.7769 | 18.9 | 1 | 1 | 0.91 | 1Score > 20 indicates identity Score > 13 indicates homology |
NATKELTFNLLNK + 3 Deamidated (NQ) |
| 3080 |
781.8938 | 1561.7730 | 1561.7592 | 8.85 | 0 | 1 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
IICPSVESISNGMR |
| 2756 |
645.3633 | 1288.7120 | 1288.6888 | 18.1 | 1 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
KVNVFNVNNNK |
| 2770 |
655.3471 | 1308.6796 | 1308.6674 | 9.38 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
HDQTTGALQLPK + Deamidated (NQ) |
| 3085 |
781.9028 | 1561.7910 | 1561.8100 | -12.1 | 1 | 1 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
DINDININFAAKSK |
| 1572 |
890.4423 | 889.4350 | 889.4392 | -4.72 | 0 | 1 | 0.97 | 1Score > 23 indicates identity Score > 13 indicates homology |
SNIANEIK + 2 Deamidated (NQ) |
| 1608 |
453.2423 | 904.4700 | 904.4614 | 9.58 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
QGNKSTIR + 2 Deamidated (NQ) |
| 3015 |
757.9141 | 1513.8136 | 1513.8075 | 4.07 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
KPTMIKLQFHNR + 2 Deamidated (NQ) |
| 2985 |
749.3754 | 1496.7362 | 1496.7147 | 14.4 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
LDSEFQPLSSAFR + Deamidated (NQ) |
| 4050 |
769.7117 | 2306.1133 | 2306.1253 | -5.21 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
TVNGGVFMNDEYLSHVILPGK + Deamidated (NQ); Oxidation (M) |
| 3021 |
759.8696 | 1517.7246 | 1517.7110 | 8.96 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
STLDWPGGASEVSGR |
| 3153 |
803.4236 | 1604.8326 | 1604.8443 | -7.28 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
LSDELKGDLSIIMR + Oxidation (M) |
| 1941 |
503.7528 | 1005.4910 | 1005.5025 | -11.4 | 1 | 1 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
REVGASMTR |
| 2427 |
567.7832 | 1133.5518 | 1133.5452 | 5.88 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
LVTDNSVEEK + Deamidated (NQ) |
| 2429 |
1135.5287 | 1134.5214 | 1134.5413 | -17.5 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
INLEMCDIK |
| 2742 |
637.3758 | 1272.7370 | 1272.7554 | -14.4 | 1 | 1 | 2.1 | 1Score > 16 indicates identity |
LPKLNVHLNPK + Deamidated (NQ) |
| 2824 |
685.3215 | 1368.6284 | 1368.6265 | 1.44 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
SMVKVMLNDNGK + 2 Deamidated (NQ); 2 Oxidation (M) |
| 3195 |
818.3994 | 1634.7842 | 1634.7933 | -5.57 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
AGSNTMNKVSGLDIAR + 2 Deamidated (NQ) |
| 4263 |
690.0931 | 2756.3433 | 2756.3641 | -7.54 | 1 | 1 | 0.98 | 1Score > 22 indicates identity Score > 13 indicates homology |
WLTFTMLILLITSHCCYWNKR + Deamidated (NQ) |
| 3000 |
753.8588 | 1505.7030 | 1505.6919 | 7.39 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
VAVQQTQMQAGVDK + 4 Deamidated (NQ) |
| 4042 |
768.3813 | 2302.1221 | 2302.1250 | -1.26 | 1 | 1 | 0.98 | 1Score > 22 indicates identity Score > 13 indicates homology |
AGLNMTKVDLLIGPNDEDELK + 2 Deamidated (NQ); Oxidation (M) |
| 1182 |
687.4040 | 686.3967 | 686.3963 | 0.66 | 0 | 1 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
DLLAQK |
| 2003 |
512.2512 | 1022.4878 | 1022.4743 | 13.3 | 0 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
YPGNPTMVK + Deamidated (NQ); Oxidation (M) |
| 4486 |
1075.5402 | 3223.5988 | 3223.6508 | -16.1 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
KPQVLKELENLLQMFEEGLPCIEHALK + 2 Deamidated (NQ); Oxidation (M) |
| 4709 |
957.2027 | 6693.3680 | 6693.4451 | -11.5 | 1 | 1 | 1.1 | 1Score > 14 indicates identity |
DVLTQWWVTLLNFLNSDTSLQIDTALELSLSIELTSVCLECLSKIMTILIILPFHSSR + 4 Deamidated (NQ) |
| 3159 |
539.5740 | 1615.7002 | 1615.7114 | -6.95 | 1 | 1 | 4 | 1Score > 19 indicates identity |
FKQEFSNAASGSGER + 2 Deamidated (NQ) |
| 2898 |
720.8370 | 1439.6594 | 1439.6780 | -12.9 | 1 | 1 | 0.95 | 1Score > 21 indicates identity Score > 13 indicates homology |
STEPVSASDKYQK + Deamidated (NQ) |
| 2614 |
590.2883 | 1178.5620 | 1178.5819 | -16.9 | 1 | 1 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
KDGLDDQFLK + Deamidated (NQ) |
| 4113 |
794.7232 | 2381.1478 | 2381.1937 | -19.3 | 0 | 1 | 1 | 1Score > 23 indicates identity Score > 13 indicates homology |
LKPPAGSQFIINDSIMSYIDR + Deamidated (NQ); Oxidation (M) |
| 1625 |
456.2321 | 910.4496 | 910.4508 | -1.30 | 0 | 1 | 4.1 | 1Score > 19 indicates identity |
DLEVNGHK |
| 1945 |
504.2640 | 1006.5134 | 1006.5137 | -0.25 | 1 | 1 | 0.93 | 1Score > 24 indicates identity Score > 13 indicates homology |
WRAWFNK |
| 2970 |
495.9148 | 1484.7226 | 1484.7367 | -9.52 | 1 | 1 | 1 | 1Score > 22 indicates identity Score > 13 indicates homology |
LRFLMDTMSDLK + Oxidation (M) |
| 1038 |
606.2745 | 605.2672 | 605.2744 | -11.9 | 0 | 1 | 4 | 1Score > 19 indicates identity |
WGMGR |
| 2241 |
542.8226 | 1083.6306 | 1083.6400 | -8.67 | 1 | 1 | 2.6 | 1Score > 17 indicates identity |
EGVGKAVVGLR |
| 4450 |
767.4041 | 3065.5873 | 3065.5339 | 17.4 | 1 | 1 | 3.7 | 1Score > 19 indicates identity |
SSNNDQLIESSLFIDIANTSMILRDIR + Deamidated (NQ) |
| 4235 |
898.4611 | 2692.3615 | 2692.3702 | -3.26 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
KPMNEIENLEALASEIQYVMLKK + 2 Deamidated (NQ) |
| 1282 |
748.3997 | 747.3924 | 747.3915 | 1.20 | 0 | 1 | 0.89 | 1Score > 21 indicates identity Score > 13 indicates homology |
WSIQSK |
| 2738 |
636.3037 | 1270.5928 | 1270.5789 | 11.0 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
NGQASAPRPNQK + 4 Deamidated (NQ) |
| 2720 |
629.3223 | 1256.6300 | 1256.6071 | 18.3 | 0 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
NQMAHLVDLAK + 2 Deamidated (NQ); Oxidation (M) |
| 2988 |
750.4126 | 1498.8106 | 1498.8395 | -19.2 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
LDLINHEKYLLK + Deamidated (NQ) |
| 2387 |
1126.5139 | 1125.5066 | 1125.5237 | -15.2 | 0 | 1 | 1 | 1Score > 20 indicates identity Score > 13 indicates homology |
CTINGVSYGR |
| 2324 |
1106.5864 | 1105.5791 | 1105.5914 | -11.1 | 1 | 1 | 0.94 | 1Score > 22 indicates identity Score > 13 indicates homology |
TAALISKSCR |
| 2719 |
419.8835 | 1256.6287 | 1256.6336 | -3.89 | 1 | 1 | 1 | 1Score > 21 indicates identity Score > 13 indicates homology |
KANQPIVHYGM |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/