MASCOT Search Results

Search metadata
User : Jennifer
E-mail : [email protected]
Search title : 1
MS data file : PRT1245_Other_P1_B9.mgf
Database : S-cerevisiae-S288C 20191206 (6,886 sequences; 3,133,934 residues)
Timestamp : 24 Jun 2025 at 21:21:15 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Deamidated (NQ), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 20 ppm
Fragment mass tolerance : ± 0.1 Da
Max missed cleavages : 1
Instrument type : ESI-FTICR
Number of queries : 4,728

Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

Unassigned peptides, 401–500 (out of 4700)

Page: Previous 1 2 3 4 5 6 7 8 9 10 … 47 Next 

Peptide matches not assigned to protein families (no details means no match)

Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
Query Observed Mr(expt) Mr(calc) ppm  M Score Expect Rank Peptide
4678 798.5556 5582.8383 5582.7643 13.3 1 2 0.84 +1Score > 14 indicates identity EYLFTSSCTLLLFNTAFGIHEQTLYHLDHSLEIFTQMRNLGNIPAGLR + 2 Deamidated (NQ)
4513 1123.2120 3366.6142 3366.6289 -4.39 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 ESVPFLRNSISQHDLSNVTTTPVPAGMPPQK + 4 Deamidated (NQ); Oxidation (M)
3644 668.7007 2003.0803 2003.0840 -1.86 1 2 2.6 +1Score > 19 indicates identity FQAERGLDVLVLLTSWR + Deamidated (NQ)
1662 923.4386 922.4313 922.4178 14.7 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 NSNAMKNK + Deamidated (NQ); Oxidation (M)
2811 674.3278 1346.6410 1346.6612 -15.0 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 QQNIEDMLRGK + Oxidation (M)
980 545.2587 544.2514 544.2493 3.93 0 2 0.76 +1Score > 14 indicates identity DADPK
1800 965.4642 964.4569 964.4648 -8.12 1 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 NMSGKGNIK + Deamidated (NQ); Oxidation (M)
4656 1100.7504 5498.7156 5498.6661 9.00 1 2 1.8 +1Score > 17 indicates identity DVNLISSISLSGEAMSQITIEANTTDLELHNTTYIELADLQRDETYQIK + 3 Deamidated (NQ)
3408 904.8972 1807.7798 1807.7770 1.56 1 2 2.1 +1Score > 18 indicates identity CQKSPSTNHWQCFK + Deamidated (NQ)
1822 973.4874 972.4801 972.4876 -7.70 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 NAGGVGELEK
3164 810.4080 1618.8014 1618.7739 17.0 0 2 0.68 +1Score > 23 indicates identity
Score > 13 indicates homology		 LITAYYNEHGPGQR + Deamidated (NQ)
3770 1038.0488 2074.0830 2074.1133 -14.6 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 LVVQVNYVGLNPVDMKIR + 2 Deamidated (NQ); Oxidation (M)
4669 927.8282 5560.9255 5561.0169 -16.4 1 2 0.59 +1Score > 13 indicates identity SSHPLLLSFHLAGKAVPIVFYIIGSMFLNFTPQFITVVLLLSFDFYLTK + Deamidated (NQ); Oxidation (M)
2816 676.8788 1351.7430 1351.7169 19.3 1 2 2.9 +1Score > 19 indicates identity VQLIQNYMKSK + Deamidated (NQ)
3262 845.4182 1688.8218 1688.8556 -20.0 1 2 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 NPTGNTVVMQPQFKK + Deamidated (NQ)
2250 1088.5419 1087.5346 1087.5509 -15.0 0 2 0.96 +1Score > 22 indicates identity
Score > 15 indicates homology		 LEEVLQNSR + Deamidated (NQ)
1103 644.3638 643.3565 643.3653 -13.6 0 2 0.86 +1Score > 21 indicates identity
Score > 14 indicates homology		 GLIANR + Deamidated (NQ)
1316 385.2410 768.4674 768.4745 -9.20 0 2 1.4 +1Score > 16 indicates identity EVAIIPK
2256 545.2949 1088.5752 1088.5826 -6.71 1 2 1 +1Score > 23 indicates identity
Score > 15 indicates homology		 RLEGELSASK
2788 662.8422 1323.6698 1323.6571 9.62 1 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 NKITYGWSAGAR + Deamidated (NQ)
3066 774.3648 1546.7150 1546.7184 -2.19 0 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 LNQPSNINMEEIK + 2 Deamidated (NQ); Oxidation (M)
2116 525.2930 1048.5714 1048.5553 15.4 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 LESFNLAVR + Deamidated (NQ)
4330 949.4595 2845.3567 2845.3811 -8.57 1 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 GGANVSGGTPSQLNSMIVGEMLRSGAAQR + Deamidated (NQ)
4466 1047.8423 3140.5051 3140.4715 10.7 1 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 CLQKLDSSNIINIMNSISSYMAQVSYK + 2 Deamidated (NQ); 2 Oxidation (M)
3590 988.4539 1974.8932 1974.9292 -18.2 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 YACVSLVGGTDFRAAMNK + Oxidation (M)
3896 1076.0211 2150.0276 2150.0612 -15.6 1 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 RSPTAECTALGAAIAANMAFK
2754 644.3175 1286.6204 1286.6216 -0.93 0 2 0.71 +1Score > 21 indicates identity
Score > 13 indicates homology		 FIGELSAEYMK
1667 924.4465 923.4392 923.4236 16.9 1 2 1 +1Score > 21 indicates identity
Score > 15 indicates homology		 AEENFVKS + Deamidated (NQ)
4335 952.1487 2853.4243 2853.4648 -14.2 0 2 1 +1Score > 22 indicates identity
Score > 15 indicates homology		 EYVSLVGQVLLDGSSLSNEEILQFSK
4066 1161.5581 2321.1016 2321.0984 1.40 1 2 0.72 +1Score > 22 indicates identity
Score > 13 indicates homology		 SINEISKELVDYFSSNISMK + 2 Deamidated (NQ); Oxidation (M)
1544 440.2343 878.4540 878.4610 -7.91 1 2 0.94 +1Score > 22 indicates identity
Score > 14 indicates homology		 TKQFEAR
1626 456.2333 910.4520 910.4508 1.33 0 2 3.1 +1Score > 20 indicates identity DLEVNGHK
1010 584.3054 583.2981 583.3078 -16.6 1 2 0.63 +1Score > 13 indicates identity KNHGK + Deamidated (NQ)
3761 1037.5480 2073.0814 2073.0854 -1.91 1 2 1 +1Score > 20 indicates identity
Score > 15 indicates homology		 AIAISNDFISNRPIKQER + 2 Deamidated (NQ)
4281 929.1259 2784.3559 2784.3350 7.49 1 2 0.75 +1Score > 22 indicates identity
Score > 13 indicates homology		 ILQITDFHFKCTDNSMTVINEIK + 2 Deamidated (NQ); Oxidation (M)
1655 920.4575 919.4502 919.4471 3.35 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 NRSSDSVR
2892 717.3405 1432.6664 1432.6755 -6.34 0 2 0.96 +1Score > 21 indicates identity
Score > 14 indicates homology		 TMQDQLDLIPNK + 2 Deamidated (NQ); Oxidation (M)
4032 1149.5520 2297.0894 2297.0746 6.46 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 FNGPNAGISQMARNIQASFEK + 2 Deamidated (NQ); Oxidation (M)
3063 773.9036 1545.7926 1545.8012 -5.51 1 2 0.88 +1Score > 22 indicates identity
Score > 14 indicates homology		 VASHKNSHNPSLVR + Deamidated (NQ)
1359 794.3688 793.3615 793.3640 -3.12 0 2 0.9 +1Score > 21 indicates identity
Score > 14 indicates homology		 LGCSETK
4058 770.3903 2308.1491 2308.1739 -10.8 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 LSNPQLDVIFTYTDWLLNR + Deamidated (NQ)
4579 1002.2921 4005.1393 4005.0887 12.6 1 2 1.1 +1Score > 15 indicates identity QKLEYLLEQISEVWLLPHWVDLANVEVLAADNTR + Deamidated (NQ)
3151 803.4144 1604.8142 1604.8409 -16.6 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 IVTNLNYNQALIAR + 3 Deamidated (NQ)
1122 328.1930 654.3714 654.3701 2.10 0 2 0.92 +1Score > 14 indicates identity SVPAPGK
1355 396.1939 790.3732 790.3821 -11.2 0 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 NESNSLK
2046 517.7688 1033.5230 1033.5193 3.67 0 2 0.81 +1Score > 24 indicates identity
Score > 13 indicates homology		 QPFTVSNNK
3071 775.3763 1548.7380 1548.7341 2.56 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 MSTIKPSPSNNNLK + 3 Deamidated (NQ); Oxidation (M)
1290 755.3965 754.3892 754.3861 4.15 0 2 1.9 +1Score > 17 indicates identity ADPLNPK + Deamidated (NQ)
3229 832.3828 1662.7510 1662.7631 -7.25 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 QVATNEMAALRNGGGR + 3 Deamidated (NQ); Oxidation (M)
2813 674.8338 1347.6530 1347.6630 -7.38 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 TQNSSQSRTPIK + 2 Deamidated (NQ)
1013 584.3411 583.3338 583.3442 -17.7 0 2 0.67 +1Score > 13 indicates identity KPPSR
3281 853.4169 1704.8192 1704.8352 -9.35 1 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 MQQLEKNAINTQIR + 3 Deamidated (NQ); Oxidation (M)
2319 553.2927 1104.5708 1104.5775 -6.01 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 NLLRDSTTGK + Deamidated (NQ)
2583 390.8729 1169.5969 1169.5941 2.34 0 2 0.92 +1Score > 21 indicates identity
Score > 14 indicates homology		 NQLHHPVPAR + 2 Deamidated (NQ)
4555 888.4315 3549.6969 3549.7144 -4.94 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 GVQSPPKPPPSNEISGTIENDVESIKQAADNMAK + 2 Deamidated (NQ)
4524 1136.2242 3405.6508 3405.6358 4.41 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 SNATNNTLGSLLPQLEAAANSNSLYGGMVPNLR + 3 Deamidated (NQ); Oxidation (M)
2610 589.7949 1177.5752 1177.5979 -19.2 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 KDGLDDQFLK
2368 560.7740 1119.5334 1119.5520 -16.6 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 LNSETRNTGK + Deamidated (NQ)
1321 386.2254 770.4362 770.4399 -4.69 1 2 2.5 +1Score > 18 indicates identity LQPRTR + Deamidated (NQ)
3232 834.3951 1666.7756 1666.7686 4.24 0 2 0.95 +1Score > 23 indicates identity
Score > 14 indicates homology		 GSNVISNDVYDQINK + 2 Deamidated (NQ)
1915 999.4786 998.4713 998.4781 -6.82 0 2 3.1 +1Score > 19 indicates identity EGVGPNVGDR
3504 951.4402 1900.8658 1900.9014 -18.7 0 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 QLSPTDNNIGGNSNNIIK + 3 Deamidated (NQ)
3924 725.0399 2172.0979 2172.1249 -12.4 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 NTANMIDPLPLSVVQQFIR + Deamidated (NQ); Oxidation (M)
4538 1146.5483 3436.6231 3436.5802 12.5 1 2 1 +1Score > 20 indicates identity
Score > 14 indicates homology		 NLEIMGAICDNYHSSVQFNLEATNNKKPPL + 4 Deamidated (NQ); Oxidation (M)
1762 953.4335 952.4262 952.4362 -10.5 1 2 2.9 +1Score > 19 indicates identity DAYRGQSR + Deamidated (NQ)
2878 711.3958 1420.7770 1420.8038 -18.8 1 2 3.1 +1Score > 19 indicates identity GSLASLVYQKSLR
3165 810.4099 1618.8052 1618.7739 19.3 0 2 0.83 +1Score > 23 indicates identity
Score > 13 indicates homology		 LITAYYNEHGPGQR + Deamidated (NQ)
3304 861.4429 1720.8712 1720.8892 -10.4 0 2 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 SLPFIEGMLTNLGAMK
3376 886.9827 1771.9508 1771.9832 -18.2 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 LLDVIINNLNNKNFK + Deamidated (NQ)
4695 866.1830 6056.2301 6056.1565 12.1 1 2 0.7 +1Score > 13 indicates identity SILALPLGVLLEPHGWWHILTGMGIYFYIVSLEHLRVITLNVSCNYQFIWR + 3 Deamidated (NQ); Oxidation (M)
4046 1152.5710 2303.1274 2303.0965 13.5 1 2 0.77 +1Score > 22 indicates identity
Score > 13 indicates homology		 KINSSPPNANGGGGGGLGGMFNVGK + Deamidated (NQ); Oxidation (M)
2517 577.7856 1153.5566 1153.5615 -4.21 1 2 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 VSKDQTSFNK + Deamidated (NQ)
3117 794.4167 1586.8188 1586.8403 -13.5 0 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 TIAETLAEELINAAK + Deamidated (NQ)
2470 573.3130 1144.6114 1144.5910 17.8 1 2 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 EPIVRQEMK + Oxidation (M)
2827 687.8698 1373.7250 1373.7514 -19.2 1 1 0.81 +1Score > 22 indicates identity
Score > 13 indicates homology		 NITLQREIGTTK + Deamidated (NQ)
1251 729.3430 728.3357 728.3381 -3.29 0 1 1.2 +1Score > 15 indicates identity TSLDFF
1353 394.7118 787.4090 787.4228 -17.5 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 LNWGGIK + Deamidated (NQ)
1576 891.4562 890.4489 890.4318 19.2 1 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 NNSRTGSR
3157 404.9311 1615.6953 1615.7148 -12.1 0 1 3.2 +1Score > 19 indicates identity SLEMTQSVSFSDNR + Oxidation (M)
958 529.2632 528.2559 528.2656 -18.3 0 1 0.72 +1Score > 13 indicates identity NNGPK
2612 1179.5538 1178.5465 1178.5601 -11.5 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 TSNNKQVMEK + Deamidated (NQ)
3102 788.3777 1574.7408 1574.7576 -10.7 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 SGVQTAYIDYSSKR + Deamidated (NQ)
1461 421.7409 841.4672 841.4545 15.1 0 1 3.1 +1Score > 19 indicates identity VPGDVLDK
1339 784.3488 783.3415 783.3511 -12.2 0 1 1.6 +1Score > 16 indicates identity QDQHQK + Deamidated (NQ)
1400 814.5010 813.4937 813.4960 -2.76 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 QIIQAIK + Deamidated (NQ)
2320 553.2930 1104.5714 1104.5788 -6.67 1 1 0.8 +1Score > 23 indicates identity
Score > 13 indicates homology		 QRSFNANLR
3947 1098.5295 2195.0444 2195.0351 4.27 0 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 VFIVTHISETTSAMNMNQR + Deamidated (NQ); Oxidation (M)
4410 993.7756 2978.3050 2978.3096 -1.54 1 1 3 +1Score > 19 indicates identity YTINFDREQLTEDMMPDINNSMLR + Deamidated (NQ); 2 Oxidation (M)
1274 742.3377 741.3304 741.3333 -3.94 0 1 2 +1Score > 17 indicates identity GEFFNK + Deamidated (NQ)
2907 723.3760 1444.7374 1444.7596 -15.3 0 1 0.96 +1Score > 22 indicates identity
Score > 14 indicates homology		 SIVEPSGALSVAGMK
3083 521.6022 1561.7848 1561.7997 -9.53 0 1 1 +1Score > 23 indicates identity
Score > 14 indicates homology		 VLQTMSFLMNHLI + Oxidation (M)
3712 1022.5385 2043.0624 2043.0928 -14.9 1 1 0.99 +1Score > 20 indicates identity
Score > 14 indicates homology		 IENFPVKIEQIIPPNYK + 2 Deamidated (NQ)
2691 611.3564 1220.6982 1220.7025 -3.50 0 1 2.9 +1Score > 18 indicates identity MIVIFCVIVK
1757 476.2171 950.4196 950.4280 -8.77 1 1 3.5 +1Score > 19 indicates identity NKNDWMK + Oxidation (M)
2389 1126.5358 1125.5285 1125.5124 14.3 0 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 TALMEQYDR
4181 634.0820 2532.2989 2532.2651 13.4 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 MCILMATRAHPDYELILISNR + Oxidation (M)
2190 535.2612 1068.5078 1068.4910 15.8 1 1 0.78 +1Score > 21 indicates identity
Score > 13 indicates homology		 EYINNCKK + Deamidated (NQ)
4463 1039.4982 3115.4728 3115.5230 -16.1 1 1 1 +1Score > 21 indicates identity
Score > 14 indicates homology		 LENDLNEELVGQLSKTMDNLENLTIPR + 2 Deamidated (NQ); Oxidation (M)
3280 852.9236 1703.8326 1703.8465 -8.12 1 1 1 +1Score > 22 indicates identity
Score > 14 indicates homology		 QKTISLDDLNDLAQK + 3 Deamidated (NQ)
1198 698.4125 697.4052 697.4123 -10.1 0 1 1.1 +1Score > 14 indicates identity VLDVPR
Page: Previous 1 2 3 4 5 6 7 8 9 10 … 47 Next 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/