MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 1 |
| MS data file | : | PRT1245_Other_P1_B9.mgf |
| Database | : | S-cerevisiae-S288C 20191206 (6,886 sequences; 3,133,934 residues) |
| Timestamp | : | 24 Jun 2025 at 21:21:15 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,728 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 2274 |
1093.5078 | 1092.5005 | 1092.4948 | 5.23 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
QPPETNHNR + Deamidated (NQ) |
| 2791 |
664.8306 | 1327.6466 | 1327.6408 | 4.41 | 0 | 4 | 0.58 | 1Score > 22 indicates identity Score > 14 indicates homology |
NSATILNYFER + Deamidated (NQ) |
| 960 |
529.2996 | 528.2923 | 528.2908 | 2.97 | 0 | 4 | 1.7 | 1Score > 18 indicates identity |
VADPK |
| 1032 |
602.3430 | 601.3357 | 601.3435 | -12.9 | 0 | 4 | 0.75 | 1Score > 23 indicates identity Score > 15 indicates homology |
ILNDK |
| 1891 |
992.5466 | 991.5393 | 991.5233 | 16.2 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
MALSRSVGR + Oxidation (M) |
| 2106 |
524.7817 | 1047.5488 | 1047.5461 | 2.58 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
ARGVEVDFR |
| 1472 |
846.4427 | 845.4354 | 845.4429 | -8.85 | 1 | 4 | 0.68 | 1Score > 24 indicates identity Score > 15 indicates homology |
KDPIMAR + Oxidation (M) |
| 3475 |
624.6149 | 1870.8229 | 1870.8405 | -9.41 | 1 | 4 | 1.9 | 1Score > 19 indicates identity |
NENKVNNATNATHNNSK + 2 Deamidated (NQ) |
| 1568 |
889.3995 | 888.3922 | 888.3937 | -1.67 | 0 | 4 | 0.92 | 1Score > 16 indicates identity |
NQDEVER |
| 907 |
487.2524 | 486.2451 | 486.2438 | 2.71 | 0 | 4 | 2.1 | 1Score > 19 indicates identity |
APDGK |
| 1524 |
870.4105 | 869.4032 | 869.4130 | -11.3 | 0 | 4 | 1.3 | 1Score > 17 indicates identity |
SLNASYSK + Deamidated (NQ) |
| 1912 |
997.5243 | 996.5170 | 996.4988 | 18.3 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
QAAPRNPNK + 2 Deamidated (NQ) |
| 3526 |
962.4270 | 1922.8394 | 1922.8204 | 9.93 | 0 | 4 | 1.4 | 1Score > 18 indicates identity |
VADENWETCQQETLAK + 2 Deamidated (NQ) |
| 938 |
502.3053 | 501.2980 | 501.2911 | 13.8 | 0 | 4 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
QGGIK |
| 1489 |
427.7112 | 853.4078 | 853.4004 | 8.76 | 0 | 4 | 1.7 | 1Score > 18 indicates identity |
FNQAVMK + Deamidated (NQ); Oxidation (M) |
| 2737 |
636.2985 | 1270.5824 | 1270.5830 | -0.42 | 1 | 4 | 0.59 | 1Score > 20 indicates identity Score > 14 indicates homology |
KFQDSGFQGEK + Deamidated (NQ) |
| 1474 |
848.3811 | 847.3738 | 847.3671 | 7.89 | 0 | 4 | 2 | 1Score > 19 indicates identity |
LGNANSDR + 2 Deamidated (NQ) |
| 1295 |
757.4202 | 756.4129 | 756.4017 | 14.8 | 0 | 4 | 2.2 | 1Score > 19 indicates identity |
ENGIPVK + Deamidated (NQ) |
| 1713 |
938.4231 | 937.4158 | 937.4215 | -6.06 | 0 | 4 | 2.2 | 1Score > 19 indicates identity |
WAVNTLMS + Deamidated (NQ); Oxidation (M) |
| 2437 |
1137.5310 | 1136.5237 | 1136.5132 | 9.29 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
AAERDNMLTT + Oxidation (M) |
| 2733 |
635.8063 | 1269.5980 | 1269.5911 | 5.50 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
STAKIDFNNMK + 2 Deamidated (NQ) |
| 1476 |
848.4073 | 847.4000 | 847.4148 | -17.4 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
NSNSTIGR |
| 3139 |
400.9397 | 1599.7297 | 1599.7352 | -3.41 | 0 | 3 | 0.76 | 1Score > 20 indicates identity Score > 15 indicates homology |
VDNYTDAIVCFQR |
| 1123 |
657.3577 | 656.3504 | 656.3493 | 1.68 | 0 | 3 | 1.1 | 1Score > 16 indicates identity |
LGENPK |
| 1076 |
628.3434 | 627.3361 | 627.3452 | -14.5 | 1 | 3 | 0.64 | 1Score > 20 indicates identity Score > 14 indicates homology |
RAEPR |
| 1561 |
442.7288 | 883.4430 | 883.4440 | -1.03 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
LEQFGYK |
| 2480 |
1147.5488 | 1146.5415 | 1146.5377 | 3.32 | 1 | 3 | 0.86 | 1Score > 20 indicates identity Score > 15 indicates homology |
SKNSNVNNNR + Deamidated (NQ) |
| 1504 |
431.2150 | 860.4154 | 860.4140 | 1.65 | 1 | 3 | 0.61 | 1Score > 22 indicates identity Score > 14 indicates homology |
KEWNQR + Deamidated (NQ) |
| 1322 |
386.2258 | 770.4370 | 770.4286 | 10.9 | 1 | 3 | 1.7 | 1Score > 18 indicates identity |
NKQGVPK + Deamidated (NQ) |
| 3495 |
947.4439 | 1892.8732 | 1892.8682 | 2.68 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
AMKEMQPQPGLVDIMR + 2 Deamidated (NQ); 3 Oxidation (M) |
| 3584 |
656.9969 | 1967.9689 | 1967.9762 | -3.70 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
GVDLEKLLEMSTEDFVK + Oxidation (M) |
| 2866 |
703.8500 | 1405.6854 | 1405.6983 | -9.16 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
IANNGTRLASMNK + Deamidated (NQ); Oxidation (M) |
| 2447 |
380.5409 | 1138.6009 | 1138.5903 | 9.24 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
MITSSKSLEK + Oxidation (M) |
| 2899 |
720.8639 | 1439.7132 | 1439.6892 | 16.7 | 0 | 3 | 0.51 | 1Score > 22 indicates identity Score > 13 indicates homology |
NNELHILDEQSK + Deamidated (NQ) |
| 2934 |
728.3945 | 1454.7744 | 1454.7868 | -8.48 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
VPENEAILLDTLK + Deamidated (NQ) |
| 2215 |
1078.5040 | 1077.4967 | 1077.5104 | -12.7 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
DFSFRHNR |
| 2439 |
1137.5386 | 1136.5313 | 1136.5132 | 16.0 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
AAERDNMLTT + Oxidation (M) |
| 3510 |
636.2982 | 1905.8728 | 1905.8738 | -0.52 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
MSENNGNPLDLSSLRNK + 2 Deamidated (NQ); Oxidation (M) |
| 2695 |
611.8293 | 1221.6440 | 1221.6209 | 18.9 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
MSKVMKPSNGK + Oxidation (M) |
| 2975 |
745.8600 | 1489.7054 | 1489.6783 | 18.2 | 0 | 3 | 0.59 | 1Score > 22 indicates identity Score > 13 indicates homology |
AVEALNDSELNGEK + 2 Deamidated (NQ) |
| 1471 |
846.4072 | 845.3999 | 845.3991 | 0.95 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
NNSQQQK |
| 2846 |
695.3430 | 1388.6714 | 1388.6646 | 4.96 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
KNIPEVDEWMK + Deamidated (NQ) |
| 4248 |
912.4641 | 2734.3705 | 2734.3695 | 0.37 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
LSVSVEQVSIAKPMSNDGVSSAVERK + 2 Deamidated (NQ); Oxidation (M) |
| 1906 |
498.7434 | 995.4722 | 995.4811 | -8.90 | 0 | 3 | 0.8 | 1Score > 21 indicates identity Score > 15 indicates homology |
ELSYDELK |
| 1498 |
429.2083 | 856.4020 | 856.3967 | 6.25 | 0 | 3 | 1.6 | 1Score > 18 indicates identity |
FVSDDFK |
| 1097 |
644.3317 | 643.3244 | 643.3289 | -6.99 | 0 | 3 | 1 | 1Score > 16 indicates identity |
TQAPAR + Deamidated (NQ) |
| 1239 |
723.3326 | 722.3253 | 722.3269 | -2.15 | 0 | 3 | 2.2 | 1Score > 19 indicates identity |
MSDNLK + Oxidation (M) |
| 1091 |
641.3633 | 640.3560 | 640.3544 | 2.51 | 0 | 3 | 0.99 | 1Score > 16 indicates identity |
NPSVPK |
| 3016 |
757.9149 | 1513.8152 | 1513.8075 | 5.13 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
KPTMIKLQFHNR + 2 Deamidated (NQ) |
| 4384 |
982.4807 | 2944.4203 | 2944.4600 | -13.5 | 1 | 3 | 0.77 | 1Score > 22 indicates identity Score > 15 indicates homology |
SLGLDVPRPMQVDFSNTLQKNADALGR + 3 Deamidated (NQ) |
| 1435 |
833.4102 | 832.4029 | 832.4151 | -14.6 | 1 | 3 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
NRTGTQR + Deamidated (NQ) |
| 2540 |
580.7850 | 1159.5554 | 1159.5770 | -18.6 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
MVPTMFPPPK + Oxidation (M) |
| 4482 |
1070.8824 | 3209.6254 | 3209.6642 | -12.1 | 1 | 3 | 2.4 | 1Score > 19 indicates identity |
EASEILAGLQGILPMDISVHQVDGGLKVYR + 2 Deamidated (NQ) |
| 1394 |
406.2257 | 810.4368 | 810.4236 | 16.4 | 0 | 3 | 2.4 | 1Score > 19 indicates identity |
LQNDPPK |
| 2216 |
1078.5118 | 1077.5045 | 1077.5104 | -5.47 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
DFSFRHNR |
| 2829 |
688.3416 | 1374.6686 | 1374.6779 | -6.74 | 0 | 3 | 1 | 1Score > 23 indicates identity Score > 16 indicates homology |
VQAVNSGYIASHK + 2 Deamidated (NQ) |
| 2680 |
607.8278 | 1213.6410 | 1213.6415 | -0.36 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 16 indicates homology |
SNQADSLPVRK |
| 1865 |
493.7317 | 985.4488 | 985.4651 | -16.5 | 0 | 3 | 1.5 | 1Score > 17 indicates identity |
EDALMVHR + Oxidation (M) |
| 3266 |
564.3004 | 1689.8794 | 1689.8542 | 14.9 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
KIICPSVESISNGMR |
| 2777 |
658.3102 | 1314.6058 | 1314.6164 | -8.02 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
AQPSSGTTNAQPR + Deamidated (NQ) |
| 2011 |
1024.5107 | 1023.5034 | 1023.5138 | -10.1 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
GGAGNIFFNK |
| 1252 |
730.3386 | 729.3313 | 729.3406 | -12.7 | 0 | 3 | 1 | 1Score > 15 indicates identity |
QSDQPR |
| 2652 |
596.8052 | 1191.5958 | 1191.5805 | 12.9 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
MKELELQER + Deamidated (NQ); Oxidation (M) |
| 4154 |
620.0781 | 2476.2833 | 2476.2818 | 0.60 | 1 | 3 | 0.57 | 1Score > 21 indicates identity Score > 13 indicates homology |
VCIEEMITSGIILFHARSTGVK + Oxidation (M) |
| 3505 |
952.9805 | 1903.9464 | 1903.9713 | -13.1 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
DLGLPQSAFSIQDLLMR + Deamidated (NQ) |
| 1104 |
323.1718 | 644.3290 | 644.3242 | 7.57 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
NGEGIR |
| 3482 |
940.4330 | 1878.8514 | 1878.8451 | 3.37 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
VRMQGEEQENIMIER + 2 Deamidated (NQ); Oxidation (M) |
| 1467 |
845.4021 | 844.3948 | 844.4039 | -10.7 | 0 | 3 | 0.57 | 1Score > 20 indicates identity Score > 13 indicates homology |
EINEQGR |
| 3129 |
797.3816 | 1592.7486 | 1592.7352 | 8.46 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
SGMIENGLQLSDNAK + Deamidated (NQ); Oxidation (M) |
| 2894 |
717.3577 | 1432.7008 | 1432.7020 | -0.82 | 1 | 3 | 0.93 | 1Score > 22 indicates identity Score > 15 indicates homology |
MSFNAFASSLSKK + Oxidation (M) |
| 1817 |
486.7362 | 971.4578 | 971.4672 | -9.65 | 0 | 3 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
TGDGSAHISK |
| 3469 |
932.9374 | 1863.8602 | 1863.8958 | -19.0 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
ENALAIGELMMGTEEIK + Oxidation (M) |
| 1142 |
669.3336 | 668.3263 | 668.3394 | -19.6 | 0 | 3 | 2.3 | 1Score > 19 indicates identity |
NWPPR |
| 3468 |
932.4607 | 1862.9068 | 1862.9230 | -8.67 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
VESPGMTGQIKSLNMAGK + Oxidation (M) |
| 2763 |
434.2117 | 1299.6133 | 1299.6315 | -14.0 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
SAYLAMCLSIR + Oxidation (M) |
| 1021 |
589.2886 | 588.2813 | 588.2867 | -9.16 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
GLNER + Deamidated (NQ) |
| 2642 |
594.8128 | 1187.6110 | 1187.6299 | -15.8 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
WQNTISNVVK |
| 3056 |
769.8671 | 1537.7196 | 1537.7233 | -2.37 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
RPDNQNPEGENLR |
| 3873 |
712.3547 | 2134.0423 | 2134.0695 | -12.7 | 1 | 3 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
LGQGTFGEVYKGIHLETQR + 2 Deamidated (NQ) |
| 3068 |
774.4073 | 1546.8000 | 1546.7739 | 16.9 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
DAAPAKPPNQGLNPR + 2 Deamidated (NQ) |
| 1861 |
984.5373 | 983.5300 | 983.5222 | 7.95 | 1 | 3 | 2.2 | 1Score > 19 indicates identity |
ADHMAKLAK |
| 4556 |
888.4355 | 3549.7129 | 3549.7144 | -0.43 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
GVQSPPKPPPSNEISGTIENDVESIKQAADNMAK + 2 Deamidated (NQ) |
| 2444 |
570.2690 | 1138.5234 | 1138.5142 | 8.12 | 0 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
SYSVNSEQPK + Deamidated (NQ) |
| 2769 |
655.3257 | 1308.6368 | 1308.6323 | 3.47 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
ANLHGYGNPNPR |
| 2107 |
524.7825 | 1047.5504 | 1047.5461 | 4.11 | 1 | 3 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
ARGVEVDFR |
| 2842 |
462.5399 | 1384.5979 | 1384.5711 | 19.4 | 1 | 3 | 2 | 1Score > 18 indicates identity |
MSNRDNESMLR + Deamidated (NQ); 2 Oxidation (M) |
| 3489 |
630.6350 | 1888.8832 | 1888.8928 | -5.11 | 1 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
GWNVRFNGAQLNANGNR + 2 Deamidated (NQ) |
| 3491 |
946.4550 | 1890.8954 | 1890.8582 | 19.7 | 0 | 3 | 0.65 | 1Score > 22 indicates identity Score > 13 indicates homology |
TVNELENTQDLLNQEK + 4 Deamidated (NQ) |
| 3913 |
722.3436 | 2164.0090 | 2163.9920 | 7.84 | 0 | 3 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
GQLDLINDGEGSLSNFADNGK + Deamidated (NQ) |
| 4103 |
790.0152 | 2367.0238 | 2366.9777 | 19.5 | 1 | 3 | 2.4 | 1Score > 19 indicates identity |
MSETRMAQNMDTTDEQYLR + 3 Oxidation (M) |
| 3032 |
762.3604 | 1522.7062 | 1522.7150 | -5.78 | 1 | 3 | 0.74 | 1Score > 21 indicates identity Score > 14 indicates homology |
ALREENEYEELK + Deamidated (NQ) |
| 3265 |
564.2998 | 1689.8776 | 1689.8542 | 13.8 | 1 | 3 | 1 | 1Score > 21 indicates identity Score > 15 indicates homology |
KIICPSVESISNGMR |
| 3363 |
880.9325 | 1759.8504 | 1759.8264 | 13.6 | 0 | 2 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
SHSEEVIVPEFNSSAK + Deamidated (NQ) |
| 2663 |
601.2907 | 1200.5668 | 1200.5887 | -18.2 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
GRGGNTWINPK + 2 Deamidated (NQ) |
| 1528 |
873.4205 | 872.4132 | 872.4174 | -4.81 | 1 | 2 | 1.6 | 1Score > 17 indicates identity |
KGHQMGAK + Deamidated (NQ); Oxidation (M) |
| 1790 |
961.4717 | 960.4644 | 960.4763 | -12.4 | 1 | 2 | 1 | 1Score > 23 indicates identity Score > 15 indicates homology |
EANEKELK + Deamidated (NQ) |
| 4131 |
809.0316 | 2424.0730 | 2424.0858 | -5.29 | 1 | 2 | 1 | 1Score > 20 indicates identity Score > 15 indicates homology |
MMTPPLNIAPNSNNSKSSIMNK + 4 Deamidated (NQ); 2 Oxidation (M) |
| 4136 |
813.7839 | 2438.3299 | 2438.3382 | -3.42 | 0 | 2 | 1 | 1Score > 15 indicates identity |
GSGTLVVILAILMLGVAYYLLNE + Deamidated (NQ); Oxidation (M) |
| 4599 |
1030.7863 | 4119.1161 | 4119.0748 | 10.0 | 1 | 2 | 2.7 | 1Score > 19 indicates identity |
EKLDMYEQAISIELSSLIELIEQEEPSPEVWLTIK + Deamidated (NQ); Oxidation (M) |
| 3800 |
696.3416 | 2086.0030 | 2085.9895 | 6.47 | 0 | 2 | 1 | 1Score > 22 indicates identity Score > 15 indicates homology |
ETVFFANGNILYPEDISR + 2 Deamidated (NQ) |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/