MASCOT Search ResultsMASCOT Search Results| User | : | Jennifer |
|---|---|---|
| : | [email protected] | |
| Search title | : | 1 |
| MS data file | : | PRT1245_Other_P1_B9.mgf |
| Database | : | S-cerevisiae-S288C 20191206 (6,886 sequences; 3,133,934 residues) |
| Timestamp | : | 24 Jun 2025 at 21:21:15 GMT |
Not what you expected? Try 
the select summary.
| Type of search | : | MS/MS Ion Search |
|---|---|---|
| Enzyme | : | Trypsin |
| Fixed modifications | : | Carbamidomethyl (C) |
| Variable modifications | : | Deamidated (NQ), Oxidation (M) |
| Mass values | : | Monoisotopic |
| Protein mass | : | Unrestricted |
| Peptide mass tolerance | : | ± 20 ppm |
| Fragment mass tolerance | : | ± 0.1 Da |
| Max missed cleavages | : | 1 |
| Instrument type | : | ESI-FTICR |
| Number of queries | : | 4,728 |
Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 21 indicate identity or extensive homology (p<0.05).
[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.
| Dupes | Expect | Rank | U | 1 | 2 | Peptide | |
|---|---|---|---|---|---|---|---|
| 0.037 |  2 |
GAYSLSLR | significant | ||||
| 9 | 1 |
GFFLFVEGGR | top ranking | ||||
| 6.4e-005 | 1 |
GSSIFGLAPGK | significant and top ranking | ||||
| 1.3e-006 | 1 |
 |
SSGTSYPDVLK | peptide is found in all proteins in family member 1 | |||
| 6.2e-007 | 1 |
 |
VCNYVSWIK | peptide is found in some but not all proteins in family member 2 | |||
| 6.4e-005 | 1 |
U | GSSIFGLAPGK | unique | |||
| 2 |
5.7e-005 | 1 |
LNTLETEEWFFK | peptide has two duplicates | |||
| 0.18 | 1 |
LNTLETEEWFFK | duplicate peptide |
Right-facing triangle () in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (
) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
|---|---|---|---|---|---|---|---|---|---|
| Query | Observed | Mr(expt) | Mr(calc) | ppm | M | Score | Expect | Rank | Peptide |
| 1729 |
942.4596 | 941.4523 | 941.4647 | -13.2 | 0 | 6 | 1 | 1Score > 20 indicates identity Score > 18 indicates homology |
WFFISGSV |
| 2856 |
699.9004 | 1397.7862 | 1397.8130 | -19.1 | 0 | 6 | 1 | 1Score > 18 indicates identity |
VVLGSDLLNDILK |
| 3005 |
754.9099 | 1507.8052 | 1507.8107 | -3.59 | 1 | 6 | 0.35 | 1Score > 20 indicates identity Score > 14 indicates homology |
LSVANVNEHQRIK + Deamidated (NQ) |
| 4295 |
701.3444 | 2801.3485 | 2801.3258 | 8.10 | 0 | 6 | 0.39 | 1Score > 23 indicates identity Score > 14 indicates homology |
NNLLYFQMWTEVEILQDDLSWK + Deamidated (NQ); Oxidation (M) |
| 3098 |
787.8965 | 1573.7784 | 1573.7988 | -12.9 | 0 | 6 | 1 | 1Score > 22 indicates identity Score > 18 indicates homology |
LELIPENFIGEGSR + Deamidated (NQ) |
| 1089 |
641.3264 | 640.3191 | 640.3254 | -9.82 | 0 | 6 | 1 | 1Score > 20 indicates identity Score > 18 indicates homology |
YLAMK + Oxidation (M) |
| 2847 |
695.3439 | 1388.6732 | 1388.6531 | 14.5 | 1 | 6 | 1 | 1Score > 22 indicates identity Score > 18 indicates homology |
NPSRSIADSAQNK + 2 Deamidated (NQ) |
| 1067 |
624.3356 | 623.3283 | 623.3279 | 0.71 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 18 indicates homology |
VSGSFK |
| 946 |
512.3517 | 511.3444 | 511.3370 | 14.6 | 0 | 5 | 0.29 | 1Score > 13 indicates identity |
IGLLP |
| 2369 |
560.7798 | 1119.5450 | 1119.5481 | -2.76 | 0 | 5 | 0.96 | 1Score > 23 indicates identity Score > 18 indicates homology |
QIMDNIIEK + Deamidated (NQ); Oxidation (M) |
| 1378 |
802.4003 | 801.3930 | 801.3981 | -6.28 | 0 | 5 | 1.2 | 1Score > 19 indicates identity |
QVNIGNR + 2 Deamidated (NQ) |
| 2561 |
583.2880 | 1164.5614 | 1164.5815 | -17.2 | 0 | 5 | 0.97 | 1Score > 22 indicates identity Score > 18 indicates homology |
NIPYNPATFK + Deamidated (NQ) |
| 1389 |
405.6860 | 809.3574 | 809.3555 | 2.39 | 0 | 5 | 0.9 | 1Score > 17 indicates identity |
EGANYQK + Deamidated (NQ) |
| 1082 |
634.3569 | 633.3496 | 633.3520 | -3.69 | 1 | 5 | 0.62 | 1Score > 22 indicates identity Score > 16 indicates homology |
DKLMK |
| 1924 |
500.7915 | 999.5684 | 999.5600 | 8.42 | 0 | 5 | 0.97 | 1Score > 20 indicates identity Score > 18 indicates homology |
NPISLNTLK + Deamidated (NQ) |
| 3188 |
816.9026 | 1631.7906 | 1631.7712 | 11.9 | 1 | 5 | 1 | 1Score > 23 indicates identity Score > 18 indicates homology |
LGQQNNLPKLDMNK + 4 Deamidated (NQ); Oxidation (M) |
| 1406 |
821.4272 | 820.4199 | 820.4079 | 14.6 | 0 | 5 | 1 | 1Score > 23 indicates identity Score > 18 indicates homology |
GVEVDFR |
| 1077 |
629.2916 | 628.2843 | 628.2929 | -13.6 | 0 | 5 | 0.46 | 1Score > 14 indicates identity |
QNPNR + Deamidated (NQ) |
| 1020 |
588.3004 | 587.2931 | 587.3027 | -16.3 | 0 | 5 | 1.2 | 1Score > 19 indicates identity |
NLDAR |
| 3036 |
764.3563 | 1526.6980 | 1526.6857 | 8.07 | 1 | 5 | 0.39 | 1Score > 21 indicates identity Score > 14 indicates homology |
ISSVRCPQCEYK + Deamidated (NQ) |
| 1814 |
971.4441 | 970.4368 | 970.4396 | -2.85 | 0 | 5 | 1.1 | 1Score > 18 indicates identity |
QIASEFNY |
| 1441 |
418.2383 | 834.4620 | 834.4599 | 2.54 | 1 | 5 | 0.6 | 1Score > 21 indicates identity Score > 16 indicates homology |
KPDGKYK |
| 2082 |
522.2571 | 1042.4996 | 1042.5005 | -0.81 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 18 indicates homology |
GITTETMYK |
| 2667 |
602.8041 | 1203.5936 | 1203.6104 | -13.9 | 1 | 5 | 0.36 | 1Score > 23 indicates identity Score > 13 indicates homology |
GPLKGCLNMSK |
| 3039 |
765.8779 | 1529.7412 | 1529.7469 | -3.72 | 0 | 5 | 1 | 1Score > 22 indicates identity Score > 18 indicates homology |
MIMNSTNTVVYIK + Deamidated (NQ); Oxidation (M) |
| 1022 |
592.2728 | 591.2655 | 591.2612 | 7.26 | 0 | 5 | 0.73 | 1Score > 16 indicates identity |
SNESR |
| 3394 |
898.9225 | 1795.8304 | 1795.8635 | -18.4 | 1 | 5 | 1 | 1Score > 21 indicates identity Score > 18 indicates homology |
VQNSANHMPQRQLEK + Deamidated (NQ); Oxidation (M) |
| 4615 |
1079.8051 | 4315.1913 | 4315.1069 | 19.6 | 1 | 5 | 1 | 1Score > 18 indicates identity |
EMIATAKSQGLVGIELLCGIVFFDEEWTPENGFVTSAQK + Deamidated (NQ) |
| 1193 |
347.2063 | 692.3980 | 692.3891 | 12.9 | 1 | 5 | 1.4 | 1Score > 19 indicates identity |
KVTAMK + Oxidation (M) |
| 2867 |
703.8532 | 1405.6918 | 1405.6759 | 11.4 | 1 | 5 | 1 | 1Score > 22 indicates identity Score > 18 indicates homology |
DVDKIIDNEMSK |
| 1085 |
637.3688 | 636.3615 | 636.3707 | -14.5 | 0 | 5 | 0.78 | 1Score > 16 indicates identity |
QHKPK |
| 1393 |
406.2207 | 810.4268 | 810.4348 | -9.79 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
VSPNAAPR |
| 1923 |
500.7900 | 999.5654 | 999.5600 | 5.42 | 1 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
VLNQIGLKN + 2 Deamidated (NQ) |
| 1737 |
472.7437 | 943.4728 | 943.4610 | 12.5 | 1 | 5 | 0.82 | 1Score > 20 indicates identity Score > 17 indicates homology |
KLNDNNPK + 2 Deamidated (NQ) |
| 2132 |
1054.4810 | 1053.4737 | 1053.4839 | -9.68 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
TDNQYTRR + Deamidated (NQ) |
| 3182 |
543.9279 | 1628.7619 | 1628.7464 | 9.47 | 0 | 5 | 0.76 | 1Score > 22 indicates identity Score > 16 indicates homology |
QITPQCVSTSHEDK |
| 2724 |
630.3016 | 1258.5886 | 1258.5902 | -1.20 | 1 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
QNLRQADDGNK + Deamidated (NQ) |
| 2939 |
729.8778 | 1457.7410 | 1457.7362 | 3.35 | 1 | 5 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
NKEDIQEVDLVR + Deamidated (NQ) |
| 1577 |
446.7365 | 891.4584 | 891.4596 | -1.32 | 1 | 5 | 0.46 | 1Score > 23 indicates identity Score > 14 indicates homology |
LGMRGQSK + Oxidation (M) |
| 3072 |
775.8599 | 1549.7052 | 1549.7120 | -4.38 | 1 | 5 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
QYSNNANNNAKSPK + Deamidated (NQ) |
| 3990 |
750.3734 | 2248.0984 | 2248.1045 | -2.72 | 0 | 5 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
QSLIELMNTINSTNVHYIR + 3 Deamidated (NQ) |
| 4239 |
900.4498 | 2698.3276 | 2698.3532 | -9.51 | 0 | 5 | 0.65 | 1Score > 22 indicates identity Score > 15 indicates homology |
YLASCIEWCAVSLLMGAQSIVTVK |
| 4651 |
1009.8877 | 5044.4021 | 5044.3330 | 13.7 | 1 | 5 | 1 | 1Score > 17 indicates identity |
YGANVGFIDFTPWISEFDMNDNKENFWPLIEHYHEVISEALR + 2 Deamidated (NQ) |
| 1179 |
687.3331 | 686.3258 | 686.3235 | 3.41 | 0 | 5 | 0.94 | 1Score > 17 indicates identity |
AENQPK + Deamidated (NQ) |
| 4041 |
1151.5695 | 2301.1244 | 2301.1675 | -18.7 | 0 | 5 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
LSMESPHVNVFSILTDLDIR + Oxidation (M) |
| 1428 |
416.2151 | 830.4156 | 830.4134 | 2.74 | 0 | 5 | 0.65 | 1Score > 22 indicates identity Score > 15 indicates homology |
EGEGQALK |
| 2152 |
530.2892 | 1058.5638 | 1058.5832 | -18.3 | 1 | 5 | 0.57 | 1Score > 22 indicates identity Score > 15 indicates homology |
LNNNISTRK |
| 1775 |
478.7373 | 955.4600 | 955.4685 | -8.80 | 0 | 5 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
VFNLMSTK + Deamidated (NQ); Oxidation (M) |
| 1451 |
421.1943 | 840.3740 | 840.3656 | 10.1 | 1 | 5 | 1.1 | 1Score > 18 indicates identity |
MGKCSMK |
| 4129 |
805.7718 | 2414.2936 | 2414.2845 | 3.74 | 1 | 5 | 1.5 | 1Score > 19 indicates identity |
AIFPNTVDGDLLKLVHLSNGYK + Deamidated (NQ) |
| 1531 |
438.7344 | 875.4542 | 875.4389 | 17.6 | 0 | 5 | 0.86 | 1Score > 22 indicates identity Score > 16 indicates homology |
NPLQFEK + Deamidated (NQ) |
| 1454 |
421.2493 | 840.4840 | 840.4818 | 2.73 | 1 | 4 | 1.1 | 1Score > 18 indicates identity |
VRAGVDPK |
| 1445 |
839.3908 | 838.3835 | 838.3742 | 11.1 | 0 | 4 | 1.5 | 1Score > 19 indicates identity |
TMEDISK + Oxidation (M) |
| 1092 |
642.3118 | 641.3045 | 641.3020 | 3.86 | 0 | 4 | 0.65 | 1Score > 15 indicates identity |
GEPDPK |
| 2631 |
592.7629 | 1183.5112 | 1183.5292 | -15.1 | 0 | 4 | 1.5 | 1Score > 19 indicates identity |
QSQFNLMSGR + Deamidated (NQ); Oxidation (M) |
| 1358 |
794.3686 | 793.3613 | 793.3640 | -3.37 | 0 | 4 | 0.51 | 1Score > 21 indicates identity Score > 14 indicates homology |
QLGDSMK + Oxidation (M) |
| 3291 |
855.8636 | 1709.7126 | 1709.7025 | 5.93 | 0 | 4 | 1.3 | 1Score > 18 indicates identity |
QCQEFEECIGGPEK |
| 3175 |
813.9491 | 1625.8836 | 1625.8559 | 17.1 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
HAKNSGNEMIIAITK |
| 3986 |
1123.5150 | 2245.0154 | 2244.9923 | 10.3 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
NYNGGHQQAINGEWDIAGVAK + 4 Deamidated (NQ) |
| 1743 |
473.7357 | 945.4568 | 945.4515 | 5.62 | 1 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
ENGRDNLK + Deamidated (NQ) |
| 3212 |
824.9062 | 1647.7978 | 1647.8146 | -10.2 | 0 | 4 | 1 | 1Score > 23 indicates identity Score > 17 indicates homology |
ILQMGAIMNLGMPSR + Deamidated (NQ); Oxidation (M) |
| 1325 |
775.3797 | 774.3724 | 774.3759 | -4.49 | 0 | 4 | 0.49 | 1Score > 23 indicates identity Score > 14 indicates homology |
EANEALK + Deamidated (NQ) |
| 1338 |
783.4725 | 782.4652 | 782.4650 | 0.25 | 0 | 4 | 0.61 | 1Score > 15 indicates identity |
DGLPLLR |
| 3879 |
1068.5300 | 2135.0454 | 2135.0146 | 14.5 | 1 | 4 | 1 | 1Score > 23 indicates identity Score > 17 indicates homology |
IQVHYMNYGESIKFFSR + Deamidated (NQ); Oxidation (M) |
| 1415 |
413.1913 | 824.3680 | 824.3738 | -7.01 | 0 | 4 | 1.4 | 1Score > 18 indicates identity |
ANIGYVMG + Deamidated (NQ) |
| 3073 |
776.8486 | 1551.6826 | 1551.6657 | 10.9 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
NTNIGGMIAECAER + Deamidated (NQ); Oxidation (M) |
| 1195 |
349.1979 | 696.3812 | 696.3919 | -15.2 | 0 | 4 | 0.63 | 1Score > 15 indicates identity |
SVNHLK |
| 1981 |
1017.5507 | 1016.5434 | 1016.5251 | 18.1 | 1 | 4 | 0.87 | 1Score > 23 indicates identity Score > 16 indicates homology |
GLNKVDTNR + Deamidated (NQ) |
| 2478 |
573.7874 | 1145.5602 | 1145.5716 | -9.94 | 1 | 4 | 0.51 | 1Score > 22 indicates identity Score > 14 indicates homology |
WNQVKLNNK + 3 Deamidated (NQ) |
| 2206 |
538.2865 | 1074.5584 | 1074.5709 | -11.6 | 0 | 4 | 0.48 | 1Score > 23 indicates identity Score > 14 indicates homology |
IWNVNTSIK + Deamidated (NQ) |
| 2223 |
540.7716 | 1079.5286 | 1079.5499 | -19.7 | 0 | 4 | 1 | 1Score > 23 indicates identity Score > 17 indicates homology |
LTLDFQTNK + Deamidated (NQ) |
| 1612 |
454.2154 | 906.4162 | 906.4303 | -15.5 | 0 | 4 | 1 | 1Score > 21 indicates identity Score > 17 indicates homology |
IMLQDMR + Deamidated (NQ) |
| 2409 |
565.3072 | 1128.5998 | 1128.6213 | -19.0 | 0 | 4 | 0.75 | 1Score > 22 indicates identity Score > 16 indicates homology |
DPIVVMVNVK + Oxidation (M) |
| 3576 |
655.6341 | 1963.8805 | 1963.9044 | -12.2 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
AANLGGVAVSGLEMAQNSQK + 4 Deamidated (NQ); Oxidation (M) |
| 1939 |
1005.4932 | 1004.4859 | 1004.4887 | -2.73 | 1 | 4 | 1 | 1Score > 23 indicates identity Score > 17 indicates homology |
RSEDSVANK |
| 2999 |
752.8997 | 1503.7848 | 1503.7967 | -7.86 | 1 | 4 | 0.86 | 1Score > 22 indicates identity Score > 16 indicates homology |
TSGPLGLNKEMLTK + Oxidation (M) |
| 1161 |
681.3214 | 680.3141 | 680.3163 | -3.22 | 1 | 4 | 1.4 | 1Score > 18 indicates identity |
KDGMSK + Oxidation (M) |
| 2993 |
751.8707 | 1501.7268 | 1501.6970 | 19.9 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
GDIESISDKTMYK + Oxidation (M) |
| 2498 |
575.7798 | 1149.5450 | 1149.5448 | 0.23 | 0 | 4 | 1 | 1Score > 23 indicates identity Score > 17 indicates homology |
NINLSEMSSR |
| 1902 |
498.2812 | 994.5478 | 994.5335 | 14.5 | 1 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
NQLKSLYK + 2 Deamidated (NQ) |
| 3144 |
801.9229 | 1601.8312 | 1601.8382 | -4.32 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 17 indicates homology |
STVPIIIRCCIDR |
| 2145 |
1058.4951 | 1057.4878 | 1057.4862 | 1.50 | 1 | 4 | 1.6 | 1Score > 19 indicates identity |
MYDTTQKR + Oxidation (M) |
| 2826 |
687.3466 | 1372.6786 | 1372.6776 | 0.80 | 0 | 4 | 0.42 | 1Score > 22 indicates identity Score > 13 indicates homology |
FAVQNFEVPHGK + Deamidated (NQ) |
| 1816 |
486.2814 | 970.5482 | 970.5521 | -4.01 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 17 indicates homology |
MSLPVTPVK |
| 1795 |
482.2395 | 962.4644 | 962.4781 | -14.2 | 1 | 4 | 0.7 | 1Score > 23 indicates identity Score > 15 indicates homology |
VTNGSSNRK + Deamidated (NQ) |
| 1363 |
398.2228 | 794.4310 | 794.4286 | 3.06 | 1 | 4 | 0.5 | 1Score > 20 indicates identity Score > 13 indicates homology |
RYNLTK + Deamidated (NQ) |
| 1405 |
820.4280 | 819.4207 | 819.4351 | -17.6 | 0 | 4 | 0.93 | 1Score > 23 indicates identity Score > 16 indicates homology |
SGAAHHIK |
| 3143 |
801.9196 | 1601.8246 | 1601.8382 | -8.44 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
STVPIIIRCCIDR |
| 1250 |
729.3420 | 728.3347 | 728.3381 | -4.66 | 0 | 4 | 0.42 | 1Score > 13 indicates identity |
TSLDFF |
| 2800 |
667.8411 | 1333.6676 | 1333.6547 | 9.68 | 0 | 4 | 0.52 | 1Score > 22 indicates identity Score > 14 indicates homology |
VENGIMQSISEK |
| 1184 |
345.1956 | 688.3766 | 688.3868 | -14.7 | 1 | 4 | 0.97 | 1Score > 24 indicates identity Score > 16 indicates homology |
ITRDGK |
| 1166 |
341.2009 | 680.3872 | 680.3969 | -14.2 | 0 | 4 | 0.41 | 1Score > 13 indicates identity |
IGNLHK |
| 2690 |
610.8278 | 1219.6410 | 1219.6561 | -12.3 | 1 | 4 | 0.77 | 1Score > 23 indicates identity Score > 15 indicates homology |
NLRLVEDSFK |
| 3411 |
907.4452 | 1812.8758 | 1812.8588 | 9.38 | 1 | 4 | 1 | 1Score > 22 indicates identity Score > 16 indicates homology |
ILSTQSENKTSSSSSEK + Deamidated (NQ) |
| 2998 |
752.8969 | 1503.7792 | 1503.7722 | 4.71 | 0 | 4 | 0.97 | 1Score > 22 indicates identity Score > 16 indicates homology |
VSFWEETILQPR |
| 1247 |
726.4495 | 725.4422 | 725.4436 | -1.84 | 0 | 4 | 0.74 | 1Score > 15 indicates identity |
VILPER |
| 1909 |
997.4598 | 996.4525 | 996.4625 | -9.97 | 0 | 4 | 1 | 1Score > 20 indicates identity Score > 16 indicates homology |
DNPPNGEVR |
| 1434 |
417.2085 | 832.4024 | 832.4113 | -10.6 | 0 | 4 | 0.52 | 1Score > 22 indicates identity Score > 13 indicates homology |
NMNLPTK + Oxidation (M) |
| 2672 |
604.3356 | 1206.6566 | 1206.6352 | 17.8 | 1 | 4 | 0.66 | 1Score > 21 indicates identity Score > 15 indicates homology |
LMKQMIDALK + Deamidated (NQ); Oxidation (M) |
| 979 |
544.3381 | 543.3308 | 543.3380 | -13.3 | 0 | 4 | 1.7 | 1Score > 19 indicates identity |
AVINK |
Not what you expected? Try the select summary.
Mascot: http://www.matrixscience.com/